StarFunc result for job id P09430

User Input

>input (55 residues)
MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09430	1.000	1.000	9.763E-8	55	1.000	1.000	P09430.pdb.gz	STP1_HUMAN Spermatid nuclear transition protein 1 OS=Homo sapiens OX=9606 GN=TNP1 PE=1 SV=2
2	AFDB:P02317	0.550	0.550	8.408E-6	55	0.873	0.873	P02317.pdb.gz	STP1_RAT Spermatid nuclear transition protein 1 OS=Rattus norvegicus OX=10116 GN=Tnp1 PE=1 SV=2
3	AFDB:A0A0R4IBM5	0.278	0.064	4.567	261	0.291	0.061	A0A0R4IBM5.pdb.gz
4	AFDB:P16554	0.240	0.034	5.824	556	0.236	0.023	P16554.pdb.gz	NUMB_DROME Protein numb OS=Drosophila melanogaster OX=7227 GN=numb PE=1 SV=2
5	AFDB:Q04182	0.271	0.019	5.824	1529	0.182	0.007	Q04182.pdb.gz	PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDR15 PE=1 SV=1
6	PDB:6rlbD	0.192	0.050	6.354	446	0.218	0.027	6rlbD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09430	5.51e-31	103	55	1.000	1.000	STP1_HUMAN Spermatid nuclear transition protein 1 OS=Homo sapiens OX=9606 GN=TNP1 PE=1 SV=2
2	P17306	1.04e-27	95.5	55	0.909	0.909	STP1_PIG Spermatid nuclear transition protein 1 OS=Sus scrofa OX=9823 GN=TNP1 PE=1 SV=2
3	P02317	1.10e-26	92.8	55	0.873	0.873	STP1_RAT Spermatid nuclear transition protein 1 OS=Rattus norvegicus OX=10116 GN=Tnp1 PE=1 SV=2
4	P10856	2.37e-26	92.0	55	0.873	0.873	STP1_MOUSE Spermatid nuclear transition protein 1 OS=Mus musculus OX=10090 GN=Tnp1 PE=2 SV=2
5	Q01094	1.2	28.1	437	0.255	0.032	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
6	Q9VFW6	1.2	28.1	599	0.273	0.025	Q9VFW6_DROME Pyrokinin 2 receptor 2, isoform A OS=Drosophila melanogaster OX=7227 GN=PK2-R2 PE=3 SV=2
7	Q6WNX7	1.3	28.1	595	0.273	0.025	Q6WNX7_DROME G-protein coupled receptor OS=Drosophila melanogaster OX=7227 GN=PK2-R2 PE=2 SV=1
8	Q8ITD0	1.4	28.1	595	0.273	0.025	Q8ITD0_DROME Putative PRXamide receptor OS=Drosophila melanogaster OX=7227 GN=PK2-R2 PE=2 SV=1
9	O09139	2.3	27.3	432	0.255	0.032	E2F1_RAT Transcription factor E2F1 OS=Rattus norvegicus OX=10116 GN=E2f1 PE=1 SV=2
10	Q61501	2.3	27.3	430	0.255	0.033	E2F1_MOUSE Transcription factor E2F1 OS=Mus musculus OX=10090 GN=E2f1 PE=1 SV=1
11	Q69ZZ9	3.3	26.9	3305	0.291	0.005	K0754_MOUSE Microtubule-actin cross-linking factor 1, isoforms 6/7 OS=Mus musculus OX=10090 GN=Macf1 PE=2 SV=3
12	A0A5K4F1D0	4.1	26.6	2566	0.273	0.006	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
13	Q9UPN3	4.1	26.6	7388	0.291	0.002	MACF1_HUMAN Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4
14	Q9QXZ0	4.6	26.6	7354	0.291	0.002	MACF1_MOUSE Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4 OS=Mus musculus OX=10090 GN=Macf1 PE=1 SV=2
15	D3ZHV2	5.4	26.2	5430	0.291	0.003	MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1
16	P10070	7.3	25.8	1586	0.273	0.009	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
17	Q6WRH9	8.0	25.8	2597	0.218	0.005	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02079 TP1	1.1e-26	103.8	Nuclear transition protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008880

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000022346	0.951	Nuclear transition protein 2
2	61853.ENSNLEP00000022650	0.769	Belongs to the histone H2B family.
3	61853.ENSNLEP00000022569	0.726	Belongs to the histone H2B family.
4	61853.ENSNLEP00000022214	0.718	Belongs to the histone H2A family.
5	61853.ENSNLEP00000022568	0.711	Belongs to the histone H2B family.
6	61853.ENSNLEP00000012383	0.704	Protamine 3
7	61853.ENSNLEP00000001508	0.697	M-phase phosphoprotein 8
8	61853.ENSNLEP00000022252	0.670	Histone cluster 1, H1e
9	61853.ENSNLEP00000023115	0.640	H1 histone family, member N, testis-specific
10	61853.ENSNLEP00000015244	0.612	Inhibitor of Bruton agammaglobulinemia tyrosine kinase
11	61853.ENSNLEP00000009442	0.591	Ankyrin repeat domain 17
12	61853.ENSNLEP00000005345	0.572	Belongs to the histone H2B family.
13	61853.ENSNLEP00000022645	0.570	Belongs to the histone H2B family.
14	61853.ENSNLEP00000001886	0.566	Nuclear protein, transcriptional regulator, 1
15	61853.ENSNLEP00000010851	0.559	Transducin (beta)-like 2
16	61853.ENSNLEP00000011480	0.559	Spermatid maturation 1
17	61853.ENSNLEP00000003810	0.554	Belongs to the histone H2A family.
18	61853.ENSNLEP00000003424	0.549	Lysine (K)-specific demethylase 3A
19	61853.ENSNLEP00000022185	0.547	Belongs to the histone H2B family.
20	61853.ENSNLEP00000022656	0.547	Belongs to the histone H2B family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	1.000	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.982	regulation of biological process
GO:0007283	0.981	spermatogenesis
GO:0016043	0.975	cellular component organization
GO:0006996	0.974	organelle organization
GO:0006325	0.968	chromatin organization
GO:0050794	0.966	regulation of cellular process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0051171	0.960	regulation of nitrogen compound metabolic process
GO:0071704	0.958	organic substance metabolic process
GO:0080090	0.957	regulation of primary metabolic process
GO:0044238	0.954	primary metabolic process
GO:0044237	0.954	cellular metabolic process
GO:0010468	0.954	regulation of gene expression
GO:0048519	0.942	negative regulation of biological process
GO:0006997	0.939	nucleus organization
GO:0031323	0.931	regulation of cellular metabolic process
GO:0006807	0.930	nitrogen compound metabolic process
GO:0043170	0.926	macromolecule metabolic process
GO:0048856	0.876	anatomical structure development
GO:0007289	0.870	spermatid nucleus differentiation
GO:0043933	0.868	protein-containing complex organization
GO:0006338	0.865	chromatin remodeling
GO:0022607	0.854	cellular component assembly
GO:0050896	0.821	response to stimulus
GO:0030317	0.817	flagellated sperm motility
GO:0009892	0.811	negative regulation of metabolic process
GO:1901360	0.809	organic cyclic compound metabolic process
GO:0046483	0.809	heterocycle metabolic process
GO:0071824	0.785	protein-DNA complex subunit organization
GO:0019219	0.762	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.757	regulation of macromolecule biosynthetic process
GO:0048523	0.754	negative regulation of cellular process
GO:0031326	0.754	regulation of cellular biosynthetic process
GO:0010605	0.750	negative regulation of macromolecule metabolic process
GO:0006139	0.743	nucleobase-containing compound metabolic process
GO:0009566	0.718	fertilization
GO:0034728	0.584	nucleosome organization
GO:0044260	0.564	cellular macromolecule metabolic process
GO:0051716	0.548	cellular response to stimulus
GO:0051252	0.496	regulation of RNA metabolic process
GO:0090304	0.459	nucleic acid metabolic process
GO:0006355	0.450	regulation of DNA-templated transcription
GO:0006950	0.380	response to stress
GO:0051172	0.371	negative regulation of nitrogen compound metabolic process
GO:0031324	0.337	negative regulation of cellular metabolic process
GO:0010558	0.314	negative regulation of macromolecule biosynthetic process
GO:0032984	0.312	protein-containing complex disassembly
GO:0031327	0.310	negative regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0000785	0.991	chromatin
GO:0005634	0.990	nucleus
GO:0032993	0.986	protein-DNA complex
GO:0000786	0.983	nucleosome
GO:0070013	0.401	intracellular organelle lumen
GO:0031981	0.387	nuclear lumen
GO:0005737	0.353	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]