StarFunc result for job id P09466

User Input

>input (180 residues)
MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVH
ITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNF
LFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09466	1.000	1.000	5.056E-35	180	1.000	1.000	P09466.pdb.gz	PAEP_HUMAN Glycodelin OS=Homo sapiens OX=9606 GN=PAEP PE=1 SV=2
2	PDB:4r0bA	0.821	0.963	5.397E-26	153	0.844	0.993	4r0bA.pdb.gz
3	AFDB:P02756	0.815	0.815	5.804E-18	180	0.444	0.444	P02756.pdb.gz	LACB_CAPHI Beta-lactoglobulin OS=Capra hircus OX=9925 GN=LGB PE=1 SV=2
4	PDB:1bsoA	0.774	0.855	3.567E-16	162	0.378	0.420	1bsoA.pdb.gz	12-Bromododecanoic acid binds inside the calyx of bovine beta-lactoglobulin.
5	PDB:6xveA	0.670	0.887	1.098E-12	134	0.328	0.440	6xveA.pdb.gz
6	AFDB:H2B3G5	0.743	0.707	9.462E-12	190	0.194	0.184	H2B3G5.pdb.gz	LI601_CANLF Lipocalin Can f 6.0101 OS=Canis lupus familiaris OX=9615 PE=1 SV=1
7	AFDB:A0A096MK41	0.729	0.725	1.116E-11	181	0.233	0.232	A0A096MK41.pdb.gz	A0A096MK41_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=Mup18 PE=3 SV=1
8	AFDB:P11590	0.736	0.744	5.503E-11	178	0.217	0.219	P11590.pdb.gz	MUP4_MOUSE Major urinary protein 4 OS=Mus musculus OX=10090 GN=Mup4 PE=1 SV=1
9	PDB:5x7yB	0.747	0.829	6.095E-11	161	0.150	0.168	5x7yB.pdb.gz
10	AFDB:E9PVW0	0.726	0.565	7.655E-11	235	0.206	0.157	E9PVW0.pdb.gz	E9PVW0_MOUSE Major urinary protein 8 OS=Mus musculus OX=10090 GN=Mup8 PE=3 SV=2
11	AFDB:P04939	0.746	0.731	1.065E-10	184	0.194	0.190	P04939.pdb.gz	MUP3_MOUSE Major urinary protein 3 OS=Mus musculus OX=10090 GN=Mup3 PE=1 SV=1
12	AFDB:Q5FW60	0.711	0.708	1.402E-10	181	0.228	0.227	Q5FW60.pdb.gz	MUP20_MOUSE Major urinary protein 20 OS=Mus musculus OX=10090 GN=Mup20 PE=1 SV=1
13	AFDB:Q6UWW0	0.652	0.641	2.430E-10	184	0.189	0.185	Q6UWW0.pdb.gz	LCN15_HUMAN Lipocalin-15 OS=Homo sapiens OX=9606 GN=LCN15 PE=1 SV=1
14	PDB:3kffA	0.705	0.823	2.692E-10	152	0.167	0.197	3kffA.pdb.gz	High resolution X-ray structures of mouse major urinary protein nasal isoform in complex with pheromones.
15	AFDB:Q99MG7	0.699	0.728	3.572E-10	172	0.172	0.180	Q99MG7.pdb.gz	FLP_MESAU Female-specific lacrimal gland protein OS=Mesocricetus auratus OX=10036 GN=FLP PE=1 SV=1
16	PDB:2lb6A	0.705	0.720	2.431E-9	176	0.172	0.176	2lb6A.pdb.gz
17	PDB:5n47A	0.634	0.634	3.574E-9	180	0.117	0.117	5n47A.pdb.gz
18	PDB:2l9cA	0.696	0.711	3.776E-9	176	0.172	0.176	2l9cA.pdb.gz
19	PDB:5n48A	0.661	0.678	1.414E-8	175	0.111	0.114	5n48A.pdb.gz
20	PDB:6s8vA	0.619	0.645	2.078E-8	172	0.100	0.105	6s8vA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09466	6.71e-134	373	180	1.000	1.000	PAEP_HUMAN Glycodelin OS=Homo sapiens OX=9606 GN=PAEP PE=1 SV=2
2	P02754	5.95e-49	158	178	0.400	0.404	LACB_BOVIN Beta-lactoglobulin OS=Bos taurus OX=9913 GN=LGB PE=1 SV=3
3	P02756	1.47e-45	149	180	0.383	0.383	LACB_CAPHI Beta-lactoglobulin OS=Capra hircus OX=9925 GN=LGB PE=1 SV=2
4	Q5FW60	1.17e-07	51.6	181	0.156	0.155	MUP20_MOUSE Major urinary protein 20 OS=Mus musculus OX=10090 GN=Mup20 PE=1 SV=1
5	P04939	2.31e-07	50.8	184	0.183	0.179	MUP3_MOUSE Major urinary protein 3 OS=Mus musculus OX=10090 GN=Mup3 PE=1 SV=1
6	Q78E14	2.68e-07	50.4	179	0.172	0.173	Q78E14_RAT Alpha-2u globulin PGCL4 OS=Rattus norvegicus OX=10116 GN=Obp3 PE=2 SV=1
7	P02761	4.71e-07	49.7	181	0.178	0.177	MUP_RAT Major urinary protein OS=Rattus norvegicus OX=10116 PE=1 SV=1
8	P04938	6.36e-07	49.3	181	0.161	0.160	MUP11_MOUSE Major urinary protein 11 OS=Mus musculus OX=10090 GN=Mup11 PE=1 SV=2
9	A2AKN8	6.54e-07	49.3	180	0.161	0.161	A2AKN8_MOUSE Major urinary protein 5 OS=Mus musculus OX=10090 GN=Mup8 PE=3 SV=1
10	P11588	6.61e-07	49.3	180	0.161	0.161	MUP1_MOUSE Major urinary protein 1 OS=Mus musculus OX=10090 GN=Mup1 PE=1 SV=1
11	P11590	8.79e-07	48.9	178	0.183	0.185	MUP4_MOUSE Major urinary protein 4 OS=Mus musculus OX=10090 GN=Mup4 PE=1 SV=1
12	E9PVW0	1.01e-06	49.3	235	0.161	0.123	E9PVW0_MOUSE Major urinary protein 8 OS=Mus musculus OX=10090 GN=Mup8 PE=3 SV=2
13	P11589	1.42e-06	48.5	180	0.161	0.161	MUP2_MOUSE Major urinary protein 2 OS=Mus musculus OX=10090 GN=Mup2 PE=1 SV=1
14	Q9PT95	2.21e-06	48.1	192	0.239	0.224	Q9PT95_DANRE Retinol binding protein OS=Danio rerio OX=7955 GN=Rpb4 PE=1 SV=1
15	Q8QGV5	2.46e-06	47.8	184	0.211	0.207	Q8QGV5_DANRE Lipocalin-type prostaglandin D synthase-like protein OS=Danio rerio OX=7955 GN=ptgds PE=1 SV=1
16	A0A8I6AMI2	5.22e-06	47.0	181	0.172	0.171	A0A8I6AMI2_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=LOC259244 PE=3 SV=1
17	A0A096MK41	8.89e-06	46.2	181	0.172	0.171	A0A096MK41_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=Mup18 PE=3 SV=1
18	A0A8I5Y2J8	9.07e-06	46.2	181	0.172	0.171	A0A8I5Y2J8_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=Mup4 PE=3 SV=1
19	A0A0G2JTN2	1.06e-05	45.8	181	0.167	0.166	A0A0G2JTN2_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=Mup4 PE=3 SV=1
20	A0A8I6ABS4	1.14e-05	45.8	181	0.161	0.160	A0A8I6ABS4_RAT Alpha-2u globulin PGCL3 OS=Rattus norvegicus OX=10116 GN=Mup4 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19481 DUF6017	5.1e+02	12.2	Family of unknown function (DUF6017)
2	PF00061 Lipocalin	3e-29	113.5	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417898

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264025	0.912	Nectin-1
2	9606.ENSP00000411355	0.894	Receptor-type tyrosine-protein phosphatase C
3	9606.ENSP00000426120	0.862	GRAM domain-containing protein 2B
4	9606.ENSP00000295897	0.790	Serum albumin
5	9606.ENSP00000363492	0.764	Growth/differentiation factor 5
6	9606.ENSP00000246891	0.739	Alpha-S1-casein
7	9606.ENSP00000263598	0.735	Lipocalin-1
8	9606.ENSP00000272224	0.720	Growth/differentiation factor 7
9	9606.ENSP00000401907	0.720	Bone morphogenetic protein receptor type-1B
10	9606.ENSP00000378326	0.703	Zona pellucida sperm-binding protein 3
11	9606.ENSP00000401502	0.691	Sialic acid-binding Ig-like lectin 6
12	9606.ENSP00000260950	0.662	Growth/differentiation factor 8
13	9606.ENSP00000341030	0.653	Beta-casein
14	9606.ENSP00000275525	0.652	Insulin-like growth factor-binding protein 1
15	9606.ENSP00000301046	0.650	Alpha-lactalbumin
16	9606.ENSP00000304822	0.650	Kappa-casein
17	9606.ENSP00000224181	0.648	Complement component C8 gamma chain
18	9606.ENSP00000380489	0.646	Myoglobin
19	9606.ENSP00000360687	0.643	Prostaglandin-H2 D-isomerase
20	9606.ENSP00000287020	0.640	Growth/differentiation factor 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.437	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048518	0.995	positive regulation of biological process
GO:0019222	0.994	regulation of metabolic process
GO:0009987	0.989	cellular process
GO:0045595	0.989	regulation of cell differentiation
GO:0048519	0.987	negative regulation of biological process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0048523	0.937	negative regulation of cellular process
GO:0051240	0.926	positive regulation of multicellular organismal process
GO:0009893	0.906	positive regulation of metabolic process
GO:0010604	0.896	positive regulation of macromolecule metabolic process
GO:0010468	0.892	regulation of gene expression
GO:0060284	0.879	regulation of cell development
GO:0050896	0.839	response to stimulus
GO:2000241	0.821	regulation of reproductive process
GO:0080090	0.816	regulation of primary metabolic process
GO:0051171	0.810	regulation of nitrogen compound metabolic process
GO:0008219	0.773	cell death
GO:1903429	0.764	regulation of cell maturation
GO:0051173	0.748	positive regulation of nitrogen compound metabolic process
GO:0051246	0.720	regulation of protein metabolic process
GO:0051247	0.698	positive regulation of protein metabolic process
GO:0010628	0.662	positive regulation of gene expression
GO:0051093	0.506	negative regulation of developmental process
GO:0001817	0.487	regulation of cytokine production
GO:0045596	0.453	negative regulation of cell differentiation
GO:0032501	0.452	multicellular organismal process
GO:0048522	0.434	positive regulation of cellular process
GO:0051716	0.414	cellular response to stimulus
GO:0012501	0.390	programmed cell death
GO:0051241	0.354	negative regulation of multicellular organismal process
GO:2000242	0.336	negative regulation of reproductive process
GO:0048856	0.315	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.875	extracellular space
GO:0005622	0.666	intracellular anatomical structure
GO:0043226	0.624	organelle
GO:0043227	0.569	membrane-bounded organelle
GO:0043229	0.467	intracellular organelle
GO:0005737	0.404	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]