StarFunc result for job id P09486

User Input

>input (303 residues)
MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAE
ETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFD
SSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYE
RDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQ
HPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKD
LVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09486	1.000	1.000	8.343E-52	303	1.000	1.000	P09486.pdb.gz	SPRC_HUMAN SPARC OS=Homo sapiens OX=9606 GN=SPARC PE=1 SV=1
2	AFDB:A0A0B5JPZ8	0.785	0.817	1.397E-40	291	0.766	0.797	A0A0B5JPZ8.pdb.gz
3	AFDB:P70663	0.746	0.353	6.003E-31	650	0.495	0.231	P70663.pdb.gz	SPRL1_MOUSE SPARC-like protein 1 OS=Mus musculus OX=10090 GN=Sparcl1 PE=1 SV=3
4	AFDB:Q14515	0.769	0.359	1.801E-30	664	0.498	0.227	Q14515.pdb.gz	SPRL1_HUMAN SPARC-like protein 1 OS=Homo sapiens OX=9606 GN=SPARCL1 PE=1 SV=2
5	AFDB:P24054	0.750	0.364	9.116E-30	634	0.485	0.232	P24054.pdb.gz	SPRL1_RAT SPARC-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sparcl1 PE=1 SV=1
6	AFDB:Q5STE3	0.214	0.091	1.227E-6	841	0.195	0.070	Q5STE3.pdb.gz	FSTL4_MOUSE Follistatin-related protein 4 OS=Mus musculus OX=10090 GN=Fstl4 PE=2 SV=1
7	AFDB:E9QJC0	0.148	0.381	2.688E-5	109	0.191	0.532	E9QJC0.pdb.gz
8	PDB:2p6aD	0.174	0.180	1.373E-3	292	0.079	0.082	2p6aD.pdb.gz	Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
9	AFDB:Q9VCR3	0.278	0.148	1.510E-3	629	0.205	0.099	Q9VCR3.pdb.gz	COW_DROME Proteoglycan Cow OS=Drosophila melanogaster OX=7227 GN=Cow PE=1 SV=3
10	PDB:3b4vD	0.157	0.216	2.571E-3	213	0.076	0.108	3b4vD.pdb.gz
11	AFDB:P25304	0.195	0.038	4.298E-3	1959	0.109	0.017	P25304.pdb.gz	AGRIN_RAT Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2
12	AFDB:Q8IYR6	0.155	0.129	7.252E-3	380	0.096	0.076	Q8IYR6.pdb.gz	TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens OX=9606 GN=TMEFF1 PE=1 SV=1
13	PDB:2xrcC	0.190	0.129	1.056E-2	454	0.053	0.035	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
14	PDB:2xrcB	0.191	0.123	2.314E-2	485	0.063	0.039	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
15	PDB:1yu6C	0.119	0.627	5.934E-2	51	0.050	0.294	1yu6C.pdb.gz	Structure of the subtilisin Carlsberg-OMTKY3 complex reveals two different ovomucoid conformations.
16	PDB:6xu4A	0.187	0.153	9.503E-2	389	0.069	0.054	6xu4A.pdb.gz	FGCaMP7, an Improved Version of Fungi-Based Ratiometric Calcium Indicator for In Vivo Visualization of Neuronal Activity.
17	PDB:6ya9A	0.182	0.147	1.001E-1	400	0.076	0.058	6ya9A.pdb.gz	Genetically encoded photo-switchable molecular sensors for optoacoustic and super-resolution imaging.
18	PDB:1s1eA	0.174	0.273	1.055E-1	181	0.083	0.138	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
19	PDB:7u0tA	0.154	0.229	1.171E-1	190	0.102	0.163	7u0tA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
20	PDB:2f2pA	0.194	0.328	1.301E-1	169	0.079	0.142	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07214	0.0	561	302	0.924	0.927	SPRC_MOUSE SPARC OS=Mus musculus OX=10090 GN=Sparc PE=1 SV=1
2	P09486	0.0	629	303	1.000	1.000	SPRC_HUMAN SPARC OS=Homo sapiens OX=9606 GN=SPARC PE=1 SV=1
3	P16975	0.0	543	301	0.924	0.930	SPRC_RAT SPARC OS=Rattus norvegicus OX=10116 GN=Sparc PE=1 SV=4
4	Q6IQH0	6.22e-174	484	291	0.772	0.804	Q6IQH0_DANRE SPARC OS=Danio rerio OX=7955 GN=hm:zeh0062 PE=1 SV=1
5	Q14515	8.62e-105	321	664	0.475	0.217	SPRL1_HUMAN SPARC-like protein 1 OS=Homo sapiens OX=9606 GN=SPARCL1 PE=1 SV=2
6	P24054	5.65e-104	318	634	0.508	0.243	SPRL1_RAT SPARC-like protein 1 OS=Rattus norvegicus OX=10116 GN=Sparcl1 PE=1 SV=1
7	P70663	2.14e-103	317	650	0.469	0.218	SPRL1_MOUSE SPARC-like protein 1 OS=Mus musculus OX=10090 GN=Sparcl1 PE=1 SV=3
8	P34714	4.96e-44	152	264	0.294	0.337	SPRC_CAEEL SPARC OS=Caenorhabditis elegans OX=6239 GN=ost-1 PE=1 SV=1
9	O97365	4.81e-30	117	304	0.254	0.253	O97365_DROME BM-40 OS=Drosophila melanogaster OX=7227 GN=SPARC PE=1 SV=1
10	Q8SY75	6.77e-29	114	304	0.251	0.250	Q8SY75_DROME RH45818p OS=Drosophila melanogaster OX=7227 GN=SPARC PE=2 SV=1
11	Q8BKV0	1.90e-09	60.5	436	0.218	0.151	TICN3_MOUSE Testican-3 OS=Mus musculus OX=10090 GN=Spock3 PE=2 SV=2
12	Q92563	2.52e-07	53.9	424	0.195	0.139	TICN2_HUMAN Testican-2 OS=Homo sapiens OX=9606 GN=SPOCK2 PE=1 SV=1
13	Q9BQ16	3.48e-07	53.5	436	0.224	0.156	TICN3_HUMAN Testican-3 OS=Homo sapiens OX=9606 GN=SPOCK3 PE=1 SV=2
14	Q9ER58	4.52e-07	53.1	423	0.201	0.144	TICN2_MOUSE Testican-2 OS=Mus musculus OX=10090 GN=Spock2 PE=1 SV=1
15	Q9H4F8	1.41e-04	45.4	434	0.076	0.053	SMOC1_HUMAN SPARC-related modular calcium-binding protein 1 OS=Homo sapiens OX=9606 GN=SMOC1 PE=1 SV=1
16	Q8BLY1	1.52e-04	45.4	463	0.076	0.050	SMOC1_MOUSE SPARC-related modular calcium-binding protein 1 OS=Mus musculus OX=10090 GN=Smoc1 PE=2 SV=2
17	P19883	2.66e-04	44.3	344	0.092	0.081	FST_HUMAN Follistatin OS=Homo sapiens OX=9606 GN=FST PE=1 SV=2
18	O95633	4.30e-04	43.5	263	0.076	0.087	FSTL3_HUMAN Follistatin-related protein 3 OS=Homo sapiens OX=9606 GN=FSTL3 PE=1 SV=1
19	Q62288	5.35e-04	43.5	442	0.185	0.127	TICN1_MOUSE Testican-1 OS=Mus musculus OX=10090 GN=Spock1 PE=2 SV=2
20	E7EDQ9	5.81e-04	43.5	461	0.073	0.048	E7EDQ9_DANRE SPARC-related modular calcium-binding 1 OS=Danio rerio OX=7955 GN=smoc1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00036 EF-hand_1	2.2e+02	12.8	EF hand
2	PF09289 FOLN	1.7e-06	39.4	Follistatin/Osteonectin-like EGF domain
3	PF12661 hEGF	1.4e+02	14.5	Human growth factor-like EGF
4	PF00050 Kazal_1	4.6e-10	50.7	Kazal-type serine protease inhibitor domain
5	PF07648 Kazal_2	8.8e-08	43.5	Kazal-type serine protease inhibitor domain
6	PF10591 SPARC_Ca_bdg	8.5e-37	137.3	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010356959.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010384431.1	0.962	Collagen type I alpha 1 chain
2	61622.XP_010387823.1	0.962	Collagen alpha-2(I) chain
3	61622.XP_010368589.1	0.909	Collagen type III alpha 1 chain
4	61622.XP_010382242.1	0.892	May affect the rate of fibrils formation.
5	61622.XP_010373286.1	0.874	Matrix metallopeptidase 2
6	61622.XP_010357300.1	0.870	Albumin
7	61622.XP_010368415.1	0.846	Collagen type VI alpha 1 chain
8	61622.XP_010368587.1	0.843	Collagen alpha-2(V) chain isoform X1
9	61622.XP_010383047.1	0.834	Collagen alpha-1(IV) chain
10	61622.XP_010354175.1	0.832	Papilin, proteoglycan like sulfated glycoprotein
11	61622.XP_010381367.1	0.828	Periostin
12	61622.XP_010367479.1	0.824	Protein disulfide isomerase family A member 4
13	61622.XP_010386362.1	0.818	SPARC/osteonectin, cwcv and kazal like domains proteoglycan 1
14	61622.XP_010369509.1	0.817	Nucleoredoxin-like 2
15	61622.XP_010370706.1	0.817	Tetratricopeptide repeat domain 27
16	61622.XP_010358012.1	0.811	SPARC/osteonectin, cwcv and kazal like domains proteoglycan 3
17	61622.XP_010365092.1	0.811	Belongs to the serpin family.
18	61622.XP_010357271.1	0.795	Collagen alpha-6(IV) chain isoform X1
19	61622.XP_010365170.1	0.795	Collagen alpha-5(IV) chain
20	61622.XP_010373928.1	0.795	Collagen alpha-4(IV) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	1.000	calcium ion binding
GO:0044877	0.981	protein-containing complex binding
GO:0005518	0.916	collagen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0032501	0.992	multicellular organismal process
GO:0048856	0.992	anatomical structure development
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0007275	0.973	multicellular organism development
GO:0048513	0.960	animal organ development
GO:0048518	0.958	positive regulation of biological process
GO:0048731	0.950	system development
GO:0048522	0.922	positive regulation of cellular process
GO:0070848	0.915	response to growth factor
GO:0071495	0.856	cellular response to endogenous stimulus
GO:2000145	0.854	regulation of cell motility
GO:0042221	0.836	response to chemical
GO:0030334	0.833	regulation of cell migration
GO:0042127	0.819	regulation of cell population proliferation
GO:0048519	0.790	negative regulation of biological process
GO:0051239	0.774	regulation of multicellular organismal process
GO:0050793	0.771	regulation of developmental process
GO:0048523	0.758	negative regulation of cellular process
GO:0010033	0.757	response to organic substance
GO:0006950	0.743	response to stress
GO:0071363	0.735	cellular response to growth factor stimulus
GO:2000026	0.721	regulation of multicellular organismal development
GO:0051093	0.717	negative regulation of developmental process
GO:0050678	0.693	regulation of epithelial cell proliferation
GO:0051241	0.678	negative regulation of multicellular organismal process
GO:1901700	0.634	response to oxygen-containing compound
GO:1901342	0.619	regulation of vasculature development
GO:0001936	0.608	regulation of endothelial cell proliferation
GO:0035295	0.595	tube development
GO:0010632	0.564	regulation of epithelial cell migration
GO:0001501	0.474	skeletal system development
GO:0019222	0.461	regulation of metabolic process
GO:0051716	0.439	cellular response to stimulus
GO:2000147	0.437	positive regulation of cell motility
GO:0030335	0.432	positive regulation of cell migration
GO:0060255	0.353	regulation of macromolecule metabolic process
GO:0009653	0.339	anatomical structure morphogenesis
GO:0010468	0.339	regulation of gene expression
GO:0008152	0.324	metabolic process
GO:0071704	0.300	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.989	cell periphery
GO:0043227	0.976	membrane-bounded organelle
GO:0005737	0.965	cytoplasm
GO:0070013	0.959	intracellular organelle lumen
GO:0012505	0.957	endomembrane system
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0005615	0.940	extracellular space
GO:0031982	0.925	vesicle
GO:0005634	0.886	nucleus
GO:0031012	0.870	extracellular matrix
GO:0062023	0.859	collagen-containing extracellular matrix
GO:0016020	0.665	membrane
GO:0005886	0.589	plasma membrane
GO:0031981	0.510	nuclear lumen
GO:0031410	0.490	cytoplasmic vesicle
GO:0009986	0.389	cell surface
GO:0016363	0.377	nuclear matrix
GO:0071682	0.377	endocytic vesicle lumen
GO:0030659	0.375	cytoplasmic vesicle membrane
GO:0031092	0.370	platelet alpha granule membrane
GO:1903561	0.366	extracellular vesicle
GO:0070062	0.363	extracellular exosome
GO:0031983	0.357	vesicle lumen
GO:0034774	0.345	secretory granule lumen
GO:0031093	0.340	platelet alpha granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]