StarFunc result for job id P09529

User Input

>input (407 residues)
MDGLPGRALGAACLLLLAAGWLGPEAWGSPTPPPTPAAPPPPPPPGSPGGSQDTCTSCGG
FRRPEELGRVDGDFLEAVKRHILSRLQMRGRPNITHAVPKAAMVTALRKLHAGKVREDGR
VEIPHLDGHASPGADGQERVSEIISFAETDGLASSRVRLYFFISNEGNQNLFVVQASLWL
YLKLLPYVLEKGSRRKVRVKVYFQEQGHGDRWNMVEKRVDLKRSGWHTFPLTEAIQALFE
RGERRLNLDVQCDSCQELAVVPVFVDPGEESHRPFVVVQARLGDSRHRIRKRGLECDGRT
NLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRM
RGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17491	0.866	0.858	2.577E-77	411	0.975	0.966	P17491.pdb.gz	INHBB_RAT Inhibin beta B chain OS=Rattus norvegicus OX=10116 GN=Inhbb PE=2 SV=2
2	AFDB:P27093	0.853	0.887	1.054E-65	391	0.826	0.859	P27093.pdb.gz	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
3	AFDB:Q91350	0.436	0.479	1.502E-54	370	0.671	0.738	Q91350.pdb.gz	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
4	AFDB:Q8QGE3	0.752	0.773	5.057E-42	395	0.437	0.451	Q8QGE3.pdb.gz	Q8QGE3_DANRE Activin beta A subunit OS=Danio rerio OX=7955 GN=actba PE=2 SV=1
5	AFDB:A4D1W7	0.440	0.422	3.327E-37	426	0.440	0.420	A4D1W7.pdb.gz	A4D1W7_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=1
6	AFDB:P55103	0.398	0.456	8.054E-31	352	0.337	0.389	P55103.pdb.gz	INHBC_HUMAN Inhibin beta C chain OS=Homo sapiens OX=9606 GN=INHBC PE=2 SV=1
7	PDB:5hlyA	0.350	0.466	1.004E-30	299	0.359	0.488	5hlyA.pdb.gz
8	AFDB:P58166	0.379	0.435	8.728E-26	350	0.292	0.340	P58166.pdb.gz	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
9	AFDB:O61643	0.325	0.155	5.588E-22	946	0.241	0.104	O61643.pdb.gz	INHB_DROME Inhibin beta chain OS=Drosophila melanogaster OX=7227 GN=Actbeta PE=1 SV=2
10	AFDB:A0A024RB20	0.302	0.302	1.284E-21	407	0.268	0.268	A0A024RB20.pdb.gz
11	AFDB:Q9VQG9	0.492	0.367	1.284E-21	586	0.206	0.143	Q9VQG9.pdb.gz	Q9VQG9_DROME Dawdle, isoform A OS=Drosophila melanogaster OX=7227 GN=daw PE=2 SV=1
12	PDB:5ntuA	0.302	0.382	1.114E-18	308	0.224	0.295	5ntuA.pdb.gz
13	PDB:5nxsA	0.287	0.384	1.641E-16	290	0.209	0.293	5nxsA.pdb.gz
14	PDB:6umxA	0.322	0.434	4.095E-15	279	0.201	0.294	6umxA.pdb.gz
15	PDB:5vqfB	0.270	0.334	9.670E-14	320	0.187	0.237	5vqfB.pdb.gz
16	PDB:3rjrC	0.262	0.305	2.349E-13	343	0.187	0.222	3rjrC.pdb.gz
17	PDB:5ffoG	0.259	0.342	2.483E-13	297	0.170	0.232	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:5nxsB	0.239	0.377	3.870E-13	251	0.189	0.307	5nxsB.pdb.gz
19	PDB:7y1rB	0.259	0.329	6.551E-12	308	0.187	0.247	7y1rB.pdb.gz
20	PDB:7l2zF	0.157	0.103	2.610E-3	664	0.049	0.030	7l2zF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09529	0.0	841	407	1.000	1.000	INHBB_HUMAN Inhibin beta B chain OS=Homo sapiens OX=9606 GN=INHBB PE=1 SV=2
2	P17491	0.0	821	411	0.975	0.966	INHBB_RAT Inhibin beta B chain OS=Rattus norvegicus OX=10116 GN=Inhbb PE=2 SV=2
3	P27093	0.0	665	391	0.781	0.813	INHBB_CHICK Inhibin beta B chain OS=Gallus gallus OX=9031 GN=INHBB PE=2 SV=2
4	Q04999	0.0	819	411	0.973	0.964	INHBB_MOUSE Inhibin beta B chain OS=Mus musculus OX=10090 GN=Inhbb PE=2 SV=4
5	Q91350	0.0	561	370	0.676	0.743	Q91350_XENLA Inhibin beta B chain OS=Xenopus laevis OX=8355 GN=inhbb.L PE=2 SV=1
6	Q04998	2.45e-113	340	424	0.437	0.420	INHBA_MOUSE Inhibin beta A chain OS=Mus musculus OX=10090 GN=Inhba PE=1 SV=1
7	A4D1W7	3.74e-113	339	426	0.435	0.415	A4D1W7_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=1
8	P08476	3.74e-113	339	426	0.435	0.415	INHBA_HUMAN Inhibin beta A chain OS=Homo sapiens OX=9606 GN=INHBA PE=1 SV=2
9	P18331	6.44e-113	338	424	0.435	0.417	INHBA_RAT Inhibin beta A chain OS=Rattus norvegicus OX=10116 GN=Inhba PE=2 SV=1
10	P07995	8.33e-112	336	425	0.432	0.414	INHBA_BOVIN Inhibin beta A chain OS=Bos taurus OX=9913 GN=INHBA PE=1 SV=2
11	Q8QGE3	2.14e-110	331	395	0.425	0.438	Q8QGE3_DANRE Activin beta A subunit OS=Danio rerio OX=7955 GN=actba PE=2 SV=1
12	P55103	2.71e-68	221	352	0.327	0.378	INHBC_HUMAN Inhibin beta C chain OS=Homo sapiens OX=9606 GN=INHBC PE=2 SV=1
13	P58166	1.45e-53	183	350	0.314	0.366	INHBE_HUMAN Inhibin beta E chain OS=Homo sapiens OX=9606 GN=INHBE PE=1 SV=1
14	Q8JFP9	3.81e-34	132	390	0.243	0.254	Q8JFP9_DANRE Gdf11-like OS=Danio rerio OX=7955 GN=gdf11 PE=2 SV=2
15	O42220	7.42e-34	131	375	0.253	0.275	GDF8_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=MSTN PE=2 SV=1
16	Q06BS3	7.42e-34	131	375	0.253	0.275	Q06BS3_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=GDF8 PE=2 SV=1
17	O61643	7.57e-34	136	946	0.260	0.112	INHB_DROME Inhibin beta chain OS=Drosophila melanogaster OX=7227 GN=Actbeta PE=1 SV=2
18	O42221	1.31e-33	131	375	0.253	0.275	GDF8_MELGA Growth/differentiation factor 8 OS=Meleagris gallopavo OX=9103 GN=MSTN PE=2 SV=2
19	D1LWV1	1.66e-33	130	375	0.253	0.275	D1LWV1_CHICK Growth/differentiation factor 8 OS=Gallus gallus OX=9031 GN=MSTN PE=2 SV=1
20	O42222	2.34e-33	130	374	0.256	0.278	GDF8_DANRE Growth/differentiation factor 8 OS=Danio rerio OX=7955 GN=mstnb PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04214 DUF411	3.6e+02	12.5	Protein of unknown function, DUF
2	PF01970 TctA	8.6e+02	10.0	Tripartite tricarboxylate transporter TctA family
3	PF00688 TGFb_propeptide	1.2e-05	36.7	TGF-beta propeptide
4	PF00019 TGF_beta	4.9e-25	99.8	Transforming growth factor beta like domain
5	PF02393 US22	89	14.8	US22 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295228

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000241416	0.981	Activin receptor type-2A
2	9606.ENSP00000243349	0.974	Activin receptor type-1C
3	9606.ENSP00000256759	0.951	Follistatin
4	9606.ENSP00000262160	0.948	Mothers against decapentaplegic homolog 2
5	9606.ENSP00000332973	0.943	Mothers against decapentaplegic homolog 3
6	9606.ENSP00000416606	0.941	Follitropin subunit beta
7	9606.ENSP00000340361	0.938	Activin receptor type-2B
8	9606.ENSP00000442656	0.933	Activin receptor type-1B
9	9606.ENSP00000263640	0.928	Activin receptor type-1
10	9606.ENSP00000482232	0.901	Glycoprotein hormones, alpha polypeptide
11	9606.ENSP00000361107	0.900	Bone morphogenetic protein receptor type-1A
12	9606.ENSP00000401907	0.894	Bone morphogenetic protein receptor type-1B
13	9606.ENSP00000242208	0.847	Inhibin beta A chain
14	9606.ENSP00000238682	0.837	Transforming growth factor beta-3
15	9606.ENSP00000287139	0.816	Nodal homolog
16	9606.ENSP00000221930	0.811	Transforming growth factor beta-1
17	9606.ENSP00000243786	0.802	Inhibin alpha chain
18	9606.ENSP00000166139	0.795	Follistatin-related protein 3
19	9606.ENSP00000341551	0.785	Mothers against decapentaplegic homolog 4
20	9606.ENSP00000316842	0.622	Homeobox protein SIX5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0098772	0.932	molecular function regulator activity
GO:0140677	0.923	molecular function activator activity
GO:0030545	0.914	signaling receptor regulator activity
GO:0048018	0.896	receptor ligand activity
GO:0042802	0.847	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0007154	0.991	cell communication
GO:0032501	0.987	multicellular organismal process
GO:0023052	0.987	signaling
GO:0048856	0.987	anatomical structure development
GO:0051716	0.987	cellular response to stimulus
GO:0023051	0.984	regulation of signaling
GO:0010646	0.984	regulation of cell communication
GO:0007165	0.982	signal transduction
GO:0048518	0.946	positive regulation of biological process
GO:0007178	0.939	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0007275	0.932	multicellular organism development
GO:0048522	0.931	positive regulation of cellular process
GO:0023056	0.915	positive regulation of signaling
GO:0010647	0.914	positive regulation of cell communication
GO:0048513	0.878	animal organ development
GO:0051239	0.871	regulation of multicellular organismal process
GO:0019222	0.869	regulation of metabolic process
GO:0060255	0.859	regulation of macromolecule metabolic process
GO:0032924	0.853	activin receptor signaling pathway
GO:0048519	0.816	negative regulation of biological process
GO:0048583	0.788	regulation of response to stimulus
GO:0048523	0.779	negative regulation of cellular process
GO:0080090	0.774	regulation of primary metabolic process
GO:0010468	0.760	regulation of gene expression
GO:0046883	0.746	regulation of hormone secretion
GO:0042221	0.745	response to chemical
GO:0048731	0.736	system development
GO:0023057	0.728	negative regulation of signaling
GO:0010648	0.723	negative regulation of cell communication
GO:0031323	0.705	regulation of cellular metabolic process
GO:0010033	0.695	response to organic substance
GO:0051171	0.692	regulation of nitrogen compound metabolic process
GO:0006950	0.679	response to stress
GO:0009966	0.613	regulation of signal transduction
GO:0046888	0.606	negative regulation of hormone secretion
GO:0009719	0.605	response to endogenous stimulus
GO:0022414	0.589	reproductive process
GO:0009893	0.546	positive regulation of metabolic process
GO:0003006	0.502	developmental process involved in reproduction
GO:0010604	0.477	positive regulation of macromolecule metabolic process
GO:0071495	0.476	cellular response to endogenous stimulus
GO:0009889	0.463	regulation of biosynthetic process
GO:0051252	0.459	regulation of RNA metabolic process
GO:0031326	0.453	regulation of cellular biosynthetic process
GO:0071363	0.447	cellular response to growth factor stimulus
GO:0048584	0.431	positive regulation of response to stimulus
GO:0050793	0.429	regulation of developmental process
GO:0030154	0.428	cell differentiation
GO:0008152	0.427	metabolic process
GO:0010556	0.422	regulation of macromolecule biosynthetic process
GO:0051240	0.420	positive regulation of multicellular organismal process
GO:0071704	0.406	organic substance metabolic process
GO:2001141	0.390	regulation of RNA biosynthetic process
GO:0006355	0.382	regulation of DNA-templated transcription
GO:0009967	0.380	positive regulation of signal transduction
GO:0031325	0.366	positive regulation of cellular metabolic process
GO:0051173	0.346	positive regulation of nitrogen compound metabolic process
GO:0045595	0.314	regulation of cell differentiation
GO:0010605	0.312	negative regulation of macromolecule metabolic process
GO:0009891	0.307	positive regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005737	0.995	cytoplasm
GO:0005615	0.874	extracellular space
GO:0071944	0.695	cell periphery
GO:0043229	0.675	intracellular organelle
GO:0016020	0.620	membrane
GO:0043227	0.353	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]