StarFunc result for job id P09543

User Input

>input (421 residues)
MNRGFSRKSHTFLPKIFFRKMSSSGAKDKPELQFPFLQDEDTVATLLECKTLFILRGLPG
SGKSTLARVIVDKYRDGTKMVSADAYKITPGARGAFSEEYKRLDEDLAAYCRRRDIRILV
LDDTNHERERLEQLFEMADQYQYQVVLVEPKTAWRLDCAQLKEKNQWQLSADDLKKLKPG
LEKDFLPLYFGWFLTKKSSETLRKAGQVFLEELGNHKAFKKELRQFVPGDEPREKMDLVT
YFGKRPPGVLHCTTKFCDYGKAPGAEEYAQQDVLKKSYSKAFTLTISALFVTPKTTGARV
ELSEQQLQLWPSDVDKLSPTDNLPRGSRAHITLGCAADVEAVQTGLDLLEILRQEKGGSR
GEEVGELSRGKLYSLGNGRWMLTLAKNMEVRAIFTGYYGKGKPVPTQGSRKGGALQSCTI
I

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09543	1.000	1.000	1.551E-87	421	1.000	1.000	P09543.pdb.gz	CN37_HUMAN 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2
2	AFDB:P13233	0.938	0.940	3.215E-75	420	0.862	0.864	P13233.pdb.gz	CN37_RAT 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Cnp PE=1 SV=2
3	AFDB:A0A2R8Q784	0.492	0.468	8.594E-28	443	0.276	0.262	A0A2R8Q784.pdb.gz
4	AFDB:Q38AF2	0.269	0.142	6.834E-11	870	0.169	0.082	Q38AF2.pdb.gz	Q38AF2_TRYB2 T4 RNA ligase 1-like N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2400 PE=4 SV=1
5	AFDB:Q92802	0.306	0.224	5.842E-10	583	0.095	0.069	Q92802.pdb.gz	N42L2_HUMAN NEDD4-binding protein 2-like 2 OS=Homo sapiens OX=9606 GN=N4BP2L2 PE=1 SV=1
6	AFDB:Q8JZS6	0.293	0.218	7.807E-10	575	0.095	0.070	Q8JZS6.pdb.gz	N42L2_MOUSE NEDD4-binding protein 2-like 2 OS=Mus musculus OX=10090 GN=N4bp2l2 PE=2 SV=2
7	AFDB:F8VQG7	0.308	0.082	1.758E-9	1678	0.086	0.021	F8VQG7.pdb.gz	F8VQG7_MOUSE NEDD4 binding protein 2 OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=1
8	AFDB:Q86UW6	0.304	0.077	1.758E-9	1770	0.078	0.019	Q86UW6.pdb.gz	N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens OX=9606 GN=N4BP2 PE=1 SV=2
9	AFDB:Q57XG4	0.269	0.141	2.350E-9	847	0.119	0.059	Q57XG4.pdb.gz	Q57XG4_TRYB2 tRNA ligase phosphodiesterase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.20 PE=4 SV=1
10	AFDB:P09880	0.251	0.139	2.963E-9	827	0.147	0.075	P09880.pdb.gz	TRNL_YEAST tRNA ligase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRL1 PE=1 SV=1
11	PDB:2axnA	0.260	0.244	2.450E-5	451	0.064	0.060	2axnA.pdb.gz	Crystal structure of the hypoxia-inducible form of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB3): a possible new target for cancer therapy.
12	PDB:2ia5H	0.253	0.344	2.450E-5	301	0.078	0.110	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
13	PDB:1k6mA	0.265	0.259	3.897E-5	432	0.076	0.074	1k6mA.pdb.gz	Tissue-specific structure/function differentiation of the liver isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase.
14	PDB:1bifA	0.264	0.258	9.302E-5	432	0.067	0.065	1bifA.pdb.gz	The crystal structure of the bifunctional enzyme 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase reveals distinct domain homologies.
15	PDB:5htkA	0.241	0.239	1.317E-4	425	0.086	0.085	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
16	PDB:1gvnB	0.189	0.284	8.930E-4	272	0.059	0.092	1gvnB.pdb.gz
17	PDB:2cdnA	0.240	0.483	1.265E-3	186	0.071	0.161	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
18	PDB:1ko5A	0.246	0.530	2.259E-3	172	0.050	0.122	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
19	PDB:7tdoA	0.162	0.162	2.536E-3	420	0.119	0.119	7tdoA.pdb.gz	Cryo-EM structure of transmembrane AAA+ protease FtsH in the ADP state.
20	PDB:2c95A	0.222	0.415	9.085E-3	195	0.078	0.169	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P06623	0.0	746	400	0.860	0.905	CN37_BOVIN 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Bos taurus OX=9913 GN=CNP PE=1 SV=2
2	P09543	0.0	867	421	1.000	1.000	CN37_HUMAN 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2
3	P13233	0.0	758	420	0.862	0.864	CN37_RAT 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Cnp PE=1 SV=2
4	P16330	0.0	748	420	0.848	0.850	CN37_MOUSE 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Mus musculus OX=10090 GN=Cnp PE=1 SV=3
5	K7ERC4	1.87e-115	336	164	0.387	0.994	K7ERC4_HUMAN 2',3'-cyclic nucleotide 3' phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=8
6	K7ERZ0	4.62e-108	317	153	0.363	1.000	K7ERZ0_HUMAN 2',3'-cyclic nucleotide 3' phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=8
7	C9K0L8	2.35e-100	296	144	0.342	1.000	C9K0L8_HUMAN 2',3'-cyclic nucleotide 3' phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=CNP PE=1 SV=2
8	Q8JZS6	2.34e-10	64.7	575	0.088	0.064	N42L2_MOUSE NEDD4-binding protein 2-like 2 OS=Mus musculus OX=10090 GN=N4bp2l2 PE=2 SV=2
9	Q92802	7.18e-10	63.2	583	0.086	0.062	N42L2_HUMAN NEDD4-binding protein 2-like 2 OS=Homo sapiens OX=9606 GN=N4BP2L2 PE=1 SV=1
10	Q8BX85	1.86e-04	46.2	836	0.067	0.033	Q8BX85_MOUSE NEDD4-binding protein 2-like 2 (Fragment) OS=Mus musculus OX=10090 GN=N4bp2 PE=2 SV=1
11	F8VQG7	3.10e-04	45.8	1678	0.067	0.017	F8VQG7_MOUSE NEDD4 binding protein 2 OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=1
12	A0A0J9YUP5	3.16e-04	45.8	1498	0.067	0.019	A0A0J9YUP5_MOUSE NEDD4 binding protein 2 (Fragment) OS=Mus musculus OX=10090 GN=N4bp2 PE=1 SV=3
13	Q69ZK1	3.28e-04	45.4	1512	0.067	0.019	Q69ZK1_MOUSE MKIAA1413 protein (Fragment) OS=Mus musculus OX=10090 GN=N4bp2 PE=2 SV=1
14	Q86UW6	3.89e-04	45.4	1770	0.069	0.016	N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens OX=9606 GN=N4BP2 PE=1 SV=2
15	O60825	0.097	37.4	505	0.074	0.061	F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2
16	Q91348	0.17	36.6	470	0.102	0.091	F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus OX=9031 PE=2 SV=2
17	O81047	0.27	36.2	639	0.052	0.034	O81047_ARATH DNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=At2g03270 PE=1 SV=2
18	P70265	0.57	35.0	519	0.074	0.060	F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus OX=10090 GN=Pfkfb2 PE=1 SV=2
19	P49750	0.60	35.0	2146	0.043	0.008	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
20	Q9JJH5	0.60	35.0	557	0.074	0.056	F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus OX=10116 GN=Pfkfb2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	0.48	21.2	6-phosphofructo-2-kinase
2	PF00004 AAA	13	17.7	ATPase family associated with various cellular activities (AAA)
3	PF13173 AAA_14	2e+02	13.4	AAA domain
4	PF13191 AAA_16	10	17.9	AAA ATPase domain
5	PF13207 AAA_17	18	17.2	AAA domain
6	PF13238 AAA_18	1e+02	14.9	AAA domain
7	PF13401 AAA_22	3.6	19.3	AAA domain
8	PF13604 AAA_30	21	16.3	AAA domain
9	PF13671 AAA_33	0.00011	33.9	AAA domain
10	PF00005 ABC_tran	17	17.4	ABC transporter
11	PF05881 CNPase	7.2e-131	446.4	2',3'-cyclic nucleotide 3'-phosphodiesterase (CNP or CNPase)
12	PF16105 DUF4823	64	14.9	Domain of unknown function (DUF4823)
13	PF08433 KTI12	9.9	17.1	Chromatin associated protein KTI12
14	PF05729 NACHT	43	15.5	NACHT domain
15	PF00931 NB-ARC	2.8e+02	12.1	NB-ARC domain
16	PF03193 RsgA_GTPase	3.2e+02	12.6	RsgA GTPase
17	PF02367 TsaE	4.9e+02	12.1	Threonylcarbamoyl adenosine biosynthesis protein TsaE
18	PF06414 Zeta_toxin	20	16.0	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377470

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380958	0.872	Myelin basic protein
2	9606.ENSP00000376048	0.802	Myelin-associated glycoprotein
3	9606.ENSP00000331040	0.766	Oligodendrocyte transcription factor 2
4	9606.ENSP00000406463	0.764	DnaJ homolog subfamily C member 7
5	9606.ENSP00000481006	0.748	Myelin proteolipid protein
6	9606.ENSP00000468500	0.744	Glial fibrillary acidic protein
7	9606.ENSP00000366095	0.696	Myelin-oligodendrocyte glycoprotein
8	9606.ENSP00000387159	0.653	C-type natriuretic peptide
9	9606.ENSP00000371785	0.645	Oligodendrocyte transcription factor 1
10	9606.ENSP00000219207	0.625	Plasmolipin
11	9606.ENSP00000463653	0.617	RNA binding protein fox-1 homolog 3
12	9606.ENSP00000312293	0.604	Myelin-associated oligodendrocyte basic protein
13	9606.ENSP00000357206	0.594	Nestin
14	9606.ENSP00000064724	0.589	Claudin-11
15	9606.ENSP00000261304	0.579	Galactocerebrosidase
16	9606.ENSP00000293328	0.577	Signal transducer and activator of transcription 5B
17	9606.ENSP00000380093	0.561	Transcription factor SOX-10
18	9606.ENSP00000360214	0.538	Opalin
19	9606.ENSP00000298910	0.537	Leucine-rich repeat serine/threonine-protein kinase 2
20	9606.ENSP00000231238	0.536	Tetratricopeptide repeat domain containing

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004113	1.000	2',3'-cyclic-nucleotide 3'-phosphodiesterase activity
GO:0005488	0.999	binding
GO:0005515	0.991	protein binding
GO:1901363	0.327	heterocyclic compound binding
GO:0097159	0.327	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0032501	0.979	multicellular organismal process
GO:0007417	0.955	central nervous system development
GO:0065007	0.701	biological regulation
GO:0071840	0.675	cellular component organization or biogenesis
GO:0050896	0.654	response to stimulus
GO:0016043	0.631	cellular component organization
GO:0007154	0.452	cell communication
GO:0023052	0.447	signaling
GO:0042221	0.393	response to chemical
GO:0050789	0.385	regulation of biological process
GO:0050794	0.373	regulation of cellular process
GO:0048513	0.316	animal organ development
GO:0007420	0.301	brain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.996	intracellular anatomical structure
GO:0005886	0.996	plasma membrane
GO:0005737	0.986	cytoplasm
GO:0043229	0.968	intracellular organelle
GO:0043227	0.944	membrane-bounded organelle
GO:0043231	0.657	intracellular membrane-bounded organelle
GO:0043232	0.407	intracellular non-membrane-bounded organelle
GO:0005856	0.350	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14489	1.000	a nucleoside 2',3'-cyclic phosphate + H2O = a nucleoside 2'-phosphate + H(+)
EC:3.1.4.37	1.000	2',3'-cyclic-nucleotide 3'-phosphodiesterase.

[back to server]