StarFunc result for job id P09544

User Input

>input (360 residues)
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09544	1.000	1.000	5.188E-68	360	1.000	1.000	P09544.pdb.gz	WNT2_HUMAN Protein Wnt-2 OS=Homo sapiens OX=9606 GN=WNT2 PE=2 SV=1
2	AFDB:Q98SN7	0.911	0.853	6.133E-54	385	0.736	0.688	Q98SN7.pdb.gz	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
3	AFDB:B0S7E3	0.867	0.790	1.918E-51	396	0.719	0.654	B0S7E3.pdb.gz
4	AFDB:Q92048	0.858	0.882	2.185E-50	350	0.675	0.694	Q92048.pdb.gz	WNT2_DANRE Protein Wnt-2 OS=Danio rerio OX=7955 GN=wnt2 PE=2 SV=1
5	AFDB:Q93097	0.860	0.794	4.283E-50	391	0.669	0.616	Q93097.pdb.gz	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
6	AFDB:B3DFK5	0.858	0.799	9.310E-50	387	0.708	0.659	B3DFK5.pdb.gz
7	AFDB:P22725	0.857	0.814	4.001E-39	380	0.469	0.445	P22725.pdb.gz	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
8	AFDB:Q3L255	0.841	0.844	9.158E-39	359	0.481	0.482	Q3L255.pdb.gz	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
9	AFDB:P31286	0.871	0.828	1.126E-38	380	0.467	0.442	P31286.pdb.gz	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2
10	AFDB:Q92050	0.846	0.839	1.186E-38	363	0.453	0.449	Q92050.pdb.gz	WNT5B_DANRE Protein Wnt-5b OS=Danio rerio OX=7955 GN=wnt5b PE=2 SV=1
11	PDB:6ahyB	0.759	0.865	6.105E-31	313	0.408	0.470	6ahyB.pdb.gz
12	PDB:4f0aB	0.664	0.801	3.663E-23	294	0.311	0.381	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:1i9gA	0.098	0.123	2.285	264	0.036	0.049	1i9gA.pdb.gz	Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
14	PDB:3b07B	0.081	0.103	2.406	270	0.011	0.015	3b07B.pdb.gz
15	PDB:7w56R	0.123	0.145	2.534	276	0.053	0.069	7w56R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
16	PDB:7pzyG	0.084	0.126	2.960	206	0.031	0.053	7pzyG.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
17	PDB:6sb3A	0.061	0.039	3.117	604	0.025	0.015	6sb3A.pdb.gz
18	PDB:2bb5A	0.116	0.105	3.457	409	0.047	0.042	2bb5A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
19	PDB:3b9yA	0.143	0.138	4.037	388	0.058	0.054	3b9yA.pdb.gz
20	PDB:7d58O	0.078	0.062	4.252	490	0.042	0.031	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70283	0.0	516	389	0.653	0.604	WNT2B_MOUSE Protein Wnt-2b OS=Mus musculus OX=10090 GN=Wnt2b PE=2 SV=3
2	P09544	0.0	750	360	1.000	1.000	WNT2_HUMAN Protein Wnt-2 OS=Homo sapiens OX=9606 GN=WNT2 PE=2 SV=1
3	P21552	0.0	725	360	0.964	0.964	WNT2_MOUSE Protein Wnt-2 OS=Mus musculus OX=10090 GN=Wnt2 PE=2 SV=2
4	Q1L130	0.0	551	396	0.708	0.644	Q1L130_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2bb PE=2 SV=1
5	Q8AY89	0.0	540	387	0.694	0.646	Q8AY89_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2b PE=2 SV=1
6	Q92048	0.0	527	350	0.678	0.697	WNT2_DANRE Protein Wnt-2 OS=Danio rerio OX=7955 GN=wnt2 PE=2 SV=1
7	Q93097	0.0	519	391	0.656	0.604	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
8	Q98SN7	0.0	572	385	0.736	0.688	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
9	Q3L257	2.08e-165	463	245	0.614	0.902	Q3L257_CHICK Protein Wnt (Fragment) OS=Gallus gallus OX=9031 GN=WNT2 PE=2 SV=1
10	P22726	2.07e-114	338	359	0.458	0.460	WNT5B_MOUSE Protein Wnt-5b OS=Mus musculus OX=10090 GN=Wnt5b PE=1 SV=2
11	Q3L255	2.26e-114	338	359	0.456	0.457	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
12	P22725	9.01e-114	337	380	0.461	0.437	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
13	P41221	9.83e-114	337	380	0.461	0.437	WNT5A_HUMAN Protein Wnt-5a OS=Homo sapiens OX=9606 GN=WNT5A PE=1 SV=2
14	Q9QXQ7	1.47e-113	337	380	0.461	0.437	WNT5A_RAT Protein Wnt-5a OS=Rattus norvegicus OX=10116 GN=Wnt5a PE=2 SV=2
15	P49337	2.97e-113	335	351	0.464	0.476	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
16	B1WBR9	4.24e-112	333	372	0.450	0.435	B1WBR9_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt5b PE=3 SV=1
17	Q9H1J7	9.28e-112	332	359	0.450	0.451	WNT5B_HUMAN Protein Wnt-5b OS=Homo sapiens OX=9606 GN=WNT5B PE=2 SV=2
18	P31286	1.19e-111	332	380	0.447	0.424	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2
19	Q9QXQ5	1.28e-111	331	351	0.447	0.459	WNT4_RAT Protein Wnt-4 OS=Rattus norvegicus OX=10116 GN=Wnt4 PE=2 SV=1
20	P22724	3.77e-111	330	351	0.447	0.459	WNT4_MOUSE Protein Wnt-4 OS=Mus musculus OX=10090 GN=Wnt4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	2.9e-119	409.8	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265441

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287934	0.989	Frizzled-1
2	9606.ENSP00000261349	0.985	Low-density lipoprotein receptor-related protein 6
3	9606.ENSP00000345785	0.977	Frizzled-9
4	9606.ENSP00000322304	0.965	Protein-serine O-palmitoleoyltransferase porcupine
5	9606.ENSP00000434034	0.965	Frizzled-4
6	9606.ENSP00000344456	0.962	Catenin beta-1
7	9606.ENSP00000220772	0.960	Secreted frizzled-related protein 1
8	9606.ENSP00000294304	0.954	Low-density lipoprotein receptor-related protein 5
9	9606.ENSP00000323901	0.950	Frizzled-2
10	9606.ENSP00000274063	0.935	Secreted frizzled-related protein 2
11	9606.ENSP00000286574	0.927	Wnt inhibitory factor 1
12	9606.ENSP00000410715	0.926	Secreted frizzled-related protein 4
13	9606.ENSP00000284523	0.923	Protein Wnt-3a
14	9606.ENSP00000363826	0.921	Frizzled-8
15	9606.ENSP00000272164	0.920	Protein Wnt-9a
16	9606.ENSP00000290015	0.920	Protein Wnt-9b
17	9606.ENSP00000478721	0.919	Tyrosine-protein kinase RYK
18	9606.ENSP00000340677	0.918	Protein Wnt-8b
19	9606.ENSP00000426653	0.918	Protein Wnt-8a
20	9606.ENSP00000354607	0.916	Frizzled-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005109	1.000	frizzled binding
GO:0048018	0.996	receptor ligand activity
GO:0005125	0.339	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.998	multicellular organismal process
GO:0048856	0.995	anatomical structure development
GO:0007165	0.990	signal transduction
GO:0007275	0.978	multicellular organism development
GO:0048731	0.959	system development
GO:0048518	0.932	positive regulation of biological process
GO:0048513	0.895	animal organ development
GO:0007166	0.893	cell surface receptor signaling pathway
GO:0048522	0.879	positive regulation of cellular process
GO:0019222	0.869	regulation of metabolic process
GO:0060255	0.858	regulation of macromolecule metabolic process
GO:0009653	0.833	anatomical structure morphogenesis
GO:0008284	0.772	positive regulation of cell population proliferation
GO:0080090	0.758	regulation of primary metabolic process
GO:0035295	0.741	tube development
GO:0009893	0.741	positive regulation of metabolic process
GO:0007267	0.731	cell-cell signaling
GO:0051171	0.700	regulation of nitrogen compound metabolic process
GO:0031323	0.700	regulation of cellular metabolic process
GO:0010468	0.698	regulation of gene expression
GO:0010604	0.672	positive regulation of macromolecule metabolic process
GO:0060322	0.649	head development
GO:0030154	0.625	cell differentiation
GO:0051173	0.611	positive regulation of nitrogen compound metabolic process
GO:0009888	0.604	tissue development
GO:0009889	0.595	regulation of biosynthetic process
GO:0031326	0.560	regulation of cellular biosynthetic process
GO:0019219	0.560	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.560	positive regulation of cellular metabolic process
GO:0010556	0.557	regulation of macromolecule biosynthetic process
GO:0008283	0.536	cell population proliferation
GO:1905114	0.511	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0198738	0.502	cell-cell signaling by wnt
GO:0016055	0.482	Wnt signaling pathway
GO:0048519	0.467	negative regulation of biological process
GO:0006355	0.457	regulation of DNA-templated transcription
GO:0050793	0.445	regulation of developmental process
GO:0009891	0.435	positive regulation of biosynthetic process
GO:0031328	0.433	positive regulation of cellular biosynthetic process
GO:0010557	0.432	positive regulation of macromolecule biosynthetic process
GO:0051239	0.429	regulation of multicellular organismal process
GO:0045935	0.428	positive regulation of nucleobase-containing compound metabolic process
GO:0048523	0.426	negative regulation of cellular process
GO:0045893	0.404	positive regulation of DNA-templated transcription
GO:0048583	0.364	regulation of response to stimulus
GO:0050678	0.363	regulation of epithelial cell proliferation
GO:0009966	0.347	regulation of signal transduction
GO:0050679	0.340	positive regulation of epithelial cell proliferation
GO:0060070	0.300	canonical Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005576	0.993	extracellular region
GO:0071944	0.946	cell periphery
GO:0016020	0.842	membrane
GO:0043227	0.825	membrane-bounded organelle
GO:0043229	0.824	intracellular organelle
GO:0043231	0.799	intracellular membrane-bounded organelle
GO:0070013	0.705	intracellular organelle lumen
GO:0012505	0.641	endomembrane system
GO:0005615	0.633	extracellular space
GO:0005886	0.449	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]