StarFunc result for job id P09603

User Input

>input (554 residues)
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
HERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
SPLTQDDRQVELPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09603	1.000	1.000	3.728E-74	554	1.000	1.000	P09603.pdb.gz	CSF1_HUMAN Macrophage colony-stimulating factor 1 OS=Homo sapiens OX=9606 GN=CSF1 PE=1 SV=2
2	AFDB:P07141	0.421	0.422	7.051E-54	552	0.706	0.708	P07141.pdb.gz	CSF1_MOUSE Macrophage colony-stimulating factor 1 OS=Mus musculus OX=10090 GN=Csf1 PE=1 SV=2
3	AFDB:Q8JZQ0	0.375	0.367	2.213E-48	566	0.655	0.641	Q8JZQ0.pdb.gz	CSF1_RAT Macrophage colony-stimulating factor 1 OS=Rattus norvegicus OX=10116 GN=Csf1 PE=1 SV=1
4	AFDB:A0A0B5JQ49	0.272	0.311	4.719E-11	482	0.186	0.214	A0A0B5JQ49.pdb.gz
5	AFDB:A0A5F8MPI9	0.116	0.066	1.766E-3	1087	0.162	0.083	A0A5F8MPI9.pdb.gz	A0A5F8MPI9_MOUSE Rap guanine nucleotide exchange factor (GEF) 1 OS=Mus musculus OX=10090 GN=Rapgef1 PE=1 SV=1
6	AFDB:F1M8L9	0.118	0.060	1.069E-2	1253	0.150	0.066	F1M8L9.pdb.gz	F1M8L9_RAT Rap guanine nucleotide exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Rapgef1 PE=1 SV=4
7	AFDB:Q3KP66	0.088	0.076	1.984E-2	663	0.182	0.152	Q3KP66.pdb.gz	INAVA_HUMAN Innate immunity activator protein OS=Homo sapiens OX=9606 GN=INAVA PE=1 SV=2
8	AFDB:Q96HB5	0.070	0.063	3.112E-2	630	0.193	0.170	Q96HB5.pdb.gz	CC120_HUMAN Coiled-coil domain-containing protein 120 OS=Homo sapiens OX=9606 GN=CCDC120 PE=1 SV=1
9	AFDB:E9PDR5	0.068	0.039	6.465E-2	1152	0.126	0.061	E9PDR5.pdb.gz	E9PDR5_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens OX=9606 GN=IBTK PE=1 SV=1
10	AFDB:Q15154	0.081	0.031	7.235E-2	2024	0.144	0.040	Q15154.pdb.gz	PCM1_HUMAN Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5
11	PDB:7zxkC	0.137	0.343	2.124E-1	166	0.036	0.120	7zxkC.pdb.gz
12	PDB:3qb1G	0.141	0.520	3.728E-1	111	0.029	0.144	3qb1G.pdb.gz
13	PDB:1buyA	0.152	0.377	3.944E-1	166	0.032	0.108	1buyA.pdb.gz
14	PDB:4p9uE	0.080	0.136	4.172E-1	272	0.040	0.081	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.
15	PDB:7u7nD	0.144	0.315	4.414E-1	191	0.042	0.120	7u7nD.pdb.gz
16	PDB:3qwrB	0.112	0.281	4.669E-1	141	0.027	0.106	3qwrB.pdb.gz
17	PDB:6df3C	0.120	0.316	6.544E-1	155	0.027	0.097	6df3C.pdb.gz
18	PDB:7ra9A	0.164	0.558	7.323E-1	126	0.027	0.119	7ra9A.pdb.gz
19	PDB:5d80G	0.066	0.125	8.195E-1	223	0.042	0.103	5d80G.pdb.gz
20	PDB:7z0lB	0.142	0.201	8.195E-1	370	0.040	0.059	7z0lB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07141	0.0	739	552	0.700	0.703	CSF1_MOUSE Macrophage colony-stimulating factor 1 OS=Mus musculus OX=10090 GN=Csf1 PE=1 SV=2
2	P09603	0.0	1125	554	1.000	1.000	CSF1_HUMAN Macrophage colony-stimulating factor 1 OS=Homo sapiens OX=9606 GN=CSF1 PE=1 SV=2
3	Q8JZQ0	0.0	662	566	0.655	0.641	CSF1_RAT Macrophage colony-stimulating factor 1 OS=Rattus norvegicus OX=10116 GN=Csf1 PE=1 SV=1
4	D8UWE0	1.96e-14	75.9	270	0.083	0.170	D8UWE0_CHICK Colony-stimulating factor 1 OS=Gallus gallus OX=9031 GN=CSF1 PE=2 SV=1
5	Q5RKM4	3.0	33.1	551	0.065	0.065	Q5RKM4_DANRE Neuroepithelial cell transforming gene 1 OS=Danio rerio OX=7955 GN=wu:fb25c11 PE=2 SV=1
6	Q6P4E1	4.1	32.7	436	0.117	0.149	GOLM2_HUMAN Protein GOLM2 OS=Homo sapiens OX=9606 GN=GOLM2 PE=1 SV=2
7	Q925Q9	4.9	32.3	709	0.065	0.051	SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3kbp1 PE=1 SV=2
8	Q8R550	5.7	32.3	709	0.065	0.051	SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Sh3kbp1 PE=1 SV=1
9	Q9V9S0	8.5	31.6	318	0.042	0.072	Q9V9S0_DROME FI04419p OS=Drosophila melanogaster OX=7227 GN=Lamp1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05337 CSF-1	2.8e-87	301.4	Macrophage colony stimulating factor-1 (CSF-1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286301	0.999	Macrophage colony-stimulating factor 1 receptor
2	9606.ENSP00000397863	0.979	Interleukin-34
3	9606.ENSP00000412237	0.977	Interleukin-10
4	9606.ENSP00000264832	0.960	Intercellular adhesion molecule 1
5	9606.ENSP00000332049	0.960	T-lymphocyte activation antigen CD86
6	9606.ENSP00000264246	0.955	T-lymphocyte activation antigen CD80
7	9606.ENSP00000386380	0.947	Interleukin-1 receptor type 1
8	9606.ENSP00000264033	0.946	E3 ubiquitin-protein ligase CBL
9	9606.ENSP00000452786	0.938	Integrin beta-3
10	9606.ENSP00000261023	0.934	Integrin alpha-V
11	9606.ENSP00000431418	0.933	High affinity nerve growth factor receptor
12	9606.ENSP00000407586	0.931	GTPase HRas
13	9606.ENSP00000265171	0.930	Pro-epidermal growth factor
14	9606.ENSP00000381775	0.929	Tumor necrosis factor ligand superfamily member 11
15	9606.ENSP00000330959	0.923	Interleukin-1 receptor type 2
16	9606.ENSP00000391669	0.913	Breast cancer anti-estrogen resistance protein 1
17	9606.ENSP00000311857	0.912	Tyrosine-protein phosphatase non-receptor type 2
18	9606.ENSP00000360683	0.908	Tyrosine-protein phosphatase non-receptor type 1
19	9606.ENSP00000264072	0.904	Low affinity immunoglobulin epsilon Fc receptor
20	9606.ENSP00000288135	0.869	Mast/stem cell growth factor receptor Kit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0005157	1.000	macrophage colony-stimulating factor receptor binding
GO:0005125	0.996	cytokine activity
GO:0008083	0.992	growth factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0023052	0.990	signaling
GO:0007154	0.990	cell communication
GO:0048583	0.990	regulation of response to stimulus
GO:0048522	0.985	positive regulation of cellular process
GO:0007165	0.977	signal transduction
GO:0060255	0.971	regulation of macromolecule metabolic process
GO:0048856	0.960	anatomical structure development
GO:0051239	0.957	regulation of multicellular organismal process
GO:0042127	0.957	regulation of cell population proliferation
GO:0048584	0.956	positive regulation of response to stimulus
GO:0030335	0.951	positive regulation of cell migration
GO:0048523	0.943	negative regulation of cellular process
GO:0023051	0.938	regulation of signaling
GO:0010646	0.938	regulation of cell communication
GO:0007166	0.937	cell surface receptor signaling pathway
GO:0008284	0.932	positive regulation of cell population proliferation
GO:0080090	0.930	regulation of primary metabolic process
GO:0051171	0.930	regulation of nitrogen compound metabolic process
GO:0010604	0.928	positive regulation of macromolecule metabolic process
GO:0010468	0.923	regulation of gene expression
GO:0051247	0.920	positive regulation of protein metabolic process
GO:0019221	0.920	cytokine-mediated signaling pathway
GO:0009966	0.917	regulation of signal transduction
GO:0051240	0.910	positive regulation of multicellular organismal process
GO:0032501	0.909	multicellular organismal process
GO:0050793	0.906	regulation of developmental process
GO:0071675	0.905	regulation of mononuclear cell migration
GO:0060284	0.900	regulation of cell development
GO:0006950	0.899	response to stress
GO:0002684	0.889	positive regulation of immune system process
GO:0060548	0.887	negative regulation of cell death
GO:2000026	0.878	regulation of multicellular organismal development
GO:0009967	0.874	positive regulation of signal transduction
GO:0010628	0.872	positive regulation of gene expression
GO:0045637	0.870	regulation of myeloid cell differentiation
GO:0030154	0.868	cell differentiation
GO:0045597	0.864	positive regulation of cell differentiation
GO:0048468	0.860	cell development
GO:0032103	0.859	positive regulation of response to external stimulus
GO:0030097	0.852	hemopoiesis
GO:0031399	0.849	regulation of protein modification process
GO:0031323	0.847	regulation of cellular metabolic process
GO:0045639	0.837	positive regulation of myeloid cell differentiation
GO:0071622	0.833	regulation of granulocyte chemotaxis
GO:0070663	0.823	regulation of leukocyte proliferation
GO:1902533	0.823	positive regulation of intracellular signal transduction
GO:0042325	0.820	regulation of phosphorylation
GO:1902105	0.820	regulation of leukocyte differentiation
GO:0002521	0.814	leukocyte differentiation
GO:0070665	0.812	positive regulation of leukocyte proliferation
GO:1902107	0.794	positive regulation of leukocyte differentiation
GO:0050921	0.790	positive regulation of chemotaxis
GO:0031325	0.785	positive regulation of cellular metabolic process
GO:0002761	0.785	regulation of myeloid leukocyte differentiation
GO:0002763	0.783	positive regulation of myeloid leukocyte differentiation
GO:1905521	0.781	regulation of macrophage migration
GO:0030099	0.772	myeloid cell differentiation
GO:0002690	0.757	positive regulation of leukocyte chemotaxis
GO:0002573	0.730	myeloid leukocyte differentiation
GO:0030225	0.709	macrophage differentiation
GO:0060759	0.648	regulation of response to cytokine stimulus
GO:1901214	0.640	regulation of neuron death
GO:0030316	0.636	osteoclast differentiation
GO:0042327	0.610	positive regulation of phosphorylation
GO:0045670	0.601	regulation of osteoclast differentiation
GO:0007275	0.556	multicellular organism development
GO:0001932	0.532	regulation of protein phosphorylation
GO:0009605	0.465	response to external stimulus
GO:0065009	0.464	regulation of molecular function
GO:0002376	0.447	immune system process
GO:0031401	0.423	positive regulation of protein modification process
GO:0007167	0.403	enzyme-linked receptor protein signaling pathway
GO:0032944	0.386	regulation of mononuclear cell proliferation
GO:0050790	0.359	regulation of catalytic activity
GO:0044093	0.359	positive regulation of molecular function
GO:0007169	0.343	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0019219	0.335	regulation of nucleobase-containing compound metabolic process
GO:0048731	0.331	system development
GO:0006355	0.326	regulation of DNA-templated transcription
GO:0043067	0.324	regulation of programmed cell death
GO:0001959	0.316	regulation of cytokine-mediated signaling pathway
GO:0032946	0.316	positive regulation of mononuclear cell proliferation
GO:0060760	0.309	positive regulation of response to cytokine stimulus
GO:0080134	0.308	regulation of response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0012505	0.996	endomembrane system
GO:0070013	0.996	intracellular organelle lumen
GO:0043227	0.986	membrane-bounded organelle
GO:0005737	0.984	cytoplasm
GO:0005654	0.977	nucleoplasm
GO:0005886	0.975	plasma membrane
GO:0032991	0.889	protein-containing complex
GO:0005783	0.693	endoplasmic reticulum
GO:0005788	0.423	endoplasmic reticulum lumen
GO:0048471	0.404	perinuclear region of cytoplasm
GO:0016604	0.372	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]