StarFunc result for job id P09619

User Input

>input (1106 residues)
MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRAEAEDSFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P05622	0.553	0.557	0.000	1098	0.854	0.861	P05622.pdb.gz	PGFRB_MOUSE Platelet-derived growth factor receptor beta OS=Mus musculus OX=10090 GN=Pdgfrb PE=1 SV=2
2	AFDB:P09619	1.000	1.000	0.000	1106	1.000	1.000	P09619.pdb.gz	PGFRB_HUMAN Platelet-derived growth factor receptor beta OS=Homo sapiens OX=9606 GN=PDGFRB PE=1 SV=1
3	AFDB:Q9PUF6	0.481	0.489	0.000	1087	0.441	0.449	Q9PUF6.pdb.gz	PGFRA_CHICK Platelet-derived growth factor receptor alpha OS=Gallus gallus OX=9031 GN=PDGFRA PE=2 SV=1
4	AFDB:Q8JFR5	0.593	0.658	3.217E-85	976	0.311	0.352	Q8JFR5.pdb.gz	KITA_DANRE Mast/stem cell growth factor receptor kita OS=Danio rerio OX=7955 GN=kita PE=2 SV=2
5	AFDB:P07333	0.278	0.315	1.446E-76	972	0.308	0.351	P07333.pdb.gz	CSF1R_HUMAN Macrophage colony-stimulating factor 1 receptor OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2
6	AFDB:F1QPE2	0.349	0.404	2.715E-75	943	0.263	0.309	F1QPE2.pdb.gz
7	AFDB:P36888	0.302	0.336	1.129E-65	993	0.249	0.277	P36888.pdb.gz	FLT3_HUMAN Receptor-type tyrosine-protein kinase FLT3 OS=Homo sapiens OX=9606 GN=FLT3 PE=1 SV=2
8	AFDB:P35918	0.348	0.292	4.422E-65	1345	0.283	0.233	P35918.pdb.gz	VGFR2_MOUSE Vascular endothelial growth factor receptor 2 OS=Mus musculus OX=10090 GN=Kdr PE=1 SV=2
9	AFDB:E7F1P1	0.303	0.349	4.495E-60	956	0.233	0.270	E7F1P1.pdb.gz	E7F1P1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=flt3 PE=3 SV=1
10	AFDB:A0A0B4J203	0.308	0.399	8.721E-49	849	0.257	0.335	A0A0B4J203.pdb.gz	A0A0B4J203_HUMAN Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 PE=3 SV=1
11	PDB:1k9aB	0.215	0.527	1.420E-18	441	0.099	0.247	1k9aB.pdb.gz
12	PDB:4fl2A	0.222	0.426	4.318E-18	555	0.086	0.171	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:1e07A	0.134	0.193	3.264E-17	642	0.086	0.148	1e07A.pdb.gz
14	PDB:2h8hA	0.211	0.500	3.799E-17	445	0.105	0.261	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:4k2rA	0.213	0.415	5.145E-17	551	0.081	0.163	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:2rcjC	0.144	0.238	8.974E-17	523	0.081	0.172	2rcjC.pdb.gz
17	PDB:5oj2B	0.155	0.228	3.020E-16	692	0.096	0.153	5oj2B.pdb.gz
18	PDB:1hzhH	0.089	0.186	8.273E-14	457	0.064	0.155	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
19	PDB:6dldD	0.124	0.389	2.214E-12	269	0.038	0.156	6dldD.pdb.gz
20	PDB:6s73A	0.205	0.768	2.214E-12	269	0.061	0.249	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D9MNA7	0.0	936	1064	0.491	0.510	D9MNA7_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=pdgfrb2 PE=2 SV=1
2	P05622	0.0	1919	1098	0.854	0.860	PGFRB_MOUSE Platelet-derived growth factor receptor beta OS=Mus musculus OX=10090 GN=Pdgfrb PE=1 SV=2
3	P09619	0.0	2279	1106	1.000	1.000	PGFRB_HUMAN Platelet-derived growth factor receptor beta OS=Homo sapiens OX=9606 GN=PDGFRB PE=1 SV=1
4	P16234	0.0	868	1089	0.444	0.451	PGFRA_HUMAN Platelet-derived growth factor receptor alpha OS=Homo sapiens OX=9606 GN=PDGFRA PE=1 SV=1
5	P20786	0.0	854	1088	0.439	0.447	PGFRA_RAT Platelet-derived growth factor receptor alpha OS=Rattus norvegicus OX=10116 GN=Pdgfra PE=1 SV=2
6	P26618	0.0	852	1089	0.440	0.447	PGFRA_MOUSE Platelet-derived growth factor receptor alpha OS=Mus musculus OX=10090 GN=Pdgfra PE=1 SV=3
7	Q05030	0.0	1920	1097	0.858	0.865	PGFRB_RAT Platelet-derived growth factor receptor beta OS=Rattus norvegicus OX=10116 GN=Pdgfrb PE=2 SV=2
8	Q9DE49	0.0	816	1059	0.426	0.445	PGFRA_DANRE Platelet-derived growth factor receptor alpha OS=Danio rerio OX=7955 GN=pdgfra PE=2 SV=1
9	Q9PUF6	0.0	842	1087	0.432	0.440	PGFRA_CHICK Platelet-derived growth factor receptor alpha OS=Gallus gallus OX=9031 GN=PDGFRA PE=2 SV=1
10	A0A0B4J203	3.66e-174	535	849	0.255	0.332	A0A0B4J203_HUMAN Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 PE=3 SV=1
11	B8A5K6	4.24e-169	525	957	0.324	0.374	B8A5K6_DANRE Mast/stem cell growth factor receptor OS=Danio rerio OX=7955 GN=kitb PE=3 SV=1
12	Q63116	5.90e-166	517	978	0.316	0.358	Q63116_RAT Mast/stem cell growth factor receptor OS=Rattus norvegicus OX=10116 GN=Kit PE=1 SV=1
13	A0A0G2JTL4	8.06e-166	516	970	0.316	0.361	A0A0G2JTL4_RAT Mast/stem cell growth factor receptor OS=Rattus norvegicus OX=10116 GN=Kit PE=1 SV=2
14	Q8JFR5	1.75e-162	508	976	0.326	0.370	KITA_DANRE Mast/stem cell growth factor receptor kita OS=Danio rerio OX=7955 GN=kita PE=2 SV=2
15	P10721	2.01e-161	505	976	0.310	0.351	KIT_HUMAN Mast/stem cell growth factor receptor Kit OS=Homo sapiens OX=9606 GN=KIT PE=1 SV=1
16	P05532	4.74e-161	504	979	0.315	0.355	KIT_MOUSE Mast/stem cell growth factor receptor Kit OS=Mus musculus OX=10090 GN=Kit PE=1 SV=3
17	P09581	9.08e-158	496	977	0.319	0.361	CSF1R_MOUSE Macrophage colony-stimulating factor 1 receptor OS=Mus musculus OX=10090 GN=Csf1r PE=1 SV=3
18	Q00495	1.65e-156	493	978	0.318	0.360	CSF1R_RAT Macrophage colony-stimulating factor 1 receptor OS=Rattus norvegicus OX=10116 GN=Csf1r PE=1 SV=1
19	P07333	8.21e-155	488	972	0.311	0.354	CSF1R_HUMAN Macrophage colony-stimulating factor 1 receptor OS=Homo sapiens OX=9606 GN=CSF1R PE=1 SV=2
20	Q9I8N6	2.24e-152	481	977	0.305	0.345	CSF1R_DANRE Macrophage colony-stimulating factor 1 receptor OS=Danio rerio OX=7955 GN=csf1r PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	0.48	22.1	Immunoglobulin C1-set domain
2	PF12330 Haspin_kinase	7.1e+02	10.5	Haspin like kinase domain
3	PF07679 I-set	2e-16	71.2	Immunoglobulin I-set domain
4	PF00047 ig	4.4e-23	92.6	Immunoglobulin domain
5	PF13895 Ig_2	5.8e-11	53.9	Immunoglobulin domain
6	PF13927 Ig_3	1.1e-22	91.7	Immunoglobulin domain
7	PF16681 Ig_5	8.9	18.2	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF00069 Pkinase	2.2e-39	147.0	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	1.5e-104	360.5	Protein tyrosine and serine/threonine kinase
10	PF10396 TrmE_N	96	14.7	GTP-binding protein TrmE N-terminus
11	PF07686 V-set	0.00023	32.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261799

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244007	0.999	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
2	9606.ENSP00000330382	0.999	Platelet-derived growth factor subunit B
3	9606.ENSP00000340944	0.998	Tyrosine-protein phosphatase non-receptor type 11
4	9606.ENSP00000428056	0.998	Phosphatidylinositol 3-kinase regulatory subunit alpha
5	9606.ENSP00000346508	0.997	Platelet-derived growth factor subunit A
6	9606.ENSP00000376865	0.995	Platelet-derived growth factor D
7	9606.ENSP00000361021	0.994	Phosphatase and tensin homolog
8	9606.ENSP00000376345	0.994	Growth factor receptor-bound protein 2
9	9606.ENSP00000274376	0.992	Ras GTPase-activating protein 1
10	9606.ENSP00000362680	0.991	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000417273	0.991	Cytoplasmic protein NCK1
12	9606.ENSP00000262613	0.987	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
13	9606.ENSP00000243077	0.984	Prolow-density lipoprotein receptor-related protein 1
14	9606.ENSP00000257290	0.983	Platelet-derived growth factor receptor alpha
15	9606.ENSP00000264657	0.982	Signal transducer and activator of transcription 3
16	9606.ENSP00000264033	0.980	E3 ubiquitin-protein ligase CBL
17	9606.ENSP00000341208	0.980	Signal transducer and activator of transcription 5A
18	9606.ENSP00000346671	0.980	Tyrosine-protein kinase Fyn
19	9606.ENSP00000233154	0.977	Cytoplasmic protein NCK2
20	9606.ENSP00000354394	0.977	Signal transducer and activator of transcription 1-alpha/beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004714	1.000	transmembrane receptor protein tyrosine kinase activity
GO:0005102	0.999	signaling receptor binding
GO:0019838	0.972	growth factor binding
GO:0019899	0.813	enzyme binding
GO:0005017	0.622	platelet-derived growth factor receptor activity
GO:0070851	0.608	growth factor receptor binding
GO:0048407	0.545	platelet-derived growth factor binding
GO:0019901	0.517	protein kinase binding
GO:0004930	0.446	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0050896	0.990	response to stimulus
GO:0048518	0.986	positive regulation of biological process
GO:0048522	0.984	positive regulation of cellular process
GO:0048856	0.983	anatomical structure development
GO:0019222	0.982	regulation of metabolic process
GO:0007165	0.979	signal transduction
GO:0048583	0.973	regulation of response to stimulus
GO:0042127	0.968	regulation of cell population proliferation
GO:0008152	0.964	metabolic process
GO:0051174	0.956	regulation of phosphorus metabolic process
GO:0060255	0.955	regulation of macromolecule metabolic process
GO:0009893	0.949	positive regulation of metabolic process
GO:0007169	0.944	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0010646	0.942	regulation of cell communication
GO:0080090	0.938	regulation of primary metabolic process
GO:0051171	0.937	regulation of nitrogen compound metabolic process
GO:0048584	0.937	positive regulation of response to stimulus
GO:0008284	0.932	positive regulation of cell population proliferation
GO:0016310	0.930	phosphorylation
GO:0043410	0.926	positive regulation of MAPK cascade
GO:0045937	0.921	positive regulation of phosphate metabolic process
GO:0018212	0.916	peptidyl-tyrosine modification
GO:0042325	0.905	regulation of phosphorylation
GO:0042327	0.903	positive regulation of phosphorylation
GO:0040017	0.895	positive regulation of locomotion
GO:0010604	0.892	positive regulation of macromolecule metabolic process
GO:0042221	0.885	response to chemical
GO:0030335	0.879	positive regulation of cell migration
GO:0031399	0.866	regulation of protein modification process
GO:0043549	0.865	regulation of kinase activity
GO:0033674	0.852	positive regulation of kinase activity
GO:0001934	0.850	positive regulation of protein phosphorylation
GO:0045859	0.848	regulation of protein kinase activity
GO:0016477	0.833	cell migration
GO:0009719	0.827	response to endogenous stimulus
GO:0071363	0.812	cellular response to growth factor stimulus
GO:0045860	0.801	positive regulation of protein kinase activity
GO:0018108	0.760	peptidyl-tyrosine phosphorylation
GO:0032501	0.751	multicellular organismal process
GO:0051336	0.743	regulation of hydrolase activity
GO:0070372	0.700	regulation of ERK1 and ERK2 cascade
GO:0070374	0.675	positive regulation of ERK1 and ERK2 cascade
GO:0070887	0.661	cellular response to chemical stimulus
GO:0046777	0.645	protein autophosphorylation
GO:0048519	0.620	negative regulation of biological process
GO:0007275	0.565	multicellular organism development
GO:0051345	0.558	positive regulation of hydrolase activity
GO:0048008	0.551	platelet-derived growth factor receptor signaling pathway
GO:0051239	0.528	regulation of multicellular organismal process
GO:0048523	0.511	negative regulation of cellular process
GO:0048513	0.470	animal organ development
GO:0035556	0.452	intracellular signal transduction
GO:0048731	0.448	system development
GO:0035924	0.444	cellular response to vascular endothelial growth factor stimulus
GO:1900274	0.421	regulation of phospholipase C activity
GO:0010468	0.420	regulation of gene expression
GO:0009653	0.409	anatomical structure morphogenesis
GO:0043550	0.407	regulation of lipid kinase activity
GO:0010518	0.401	positive regulation of phospholipase activity
GO:0030154	0.400	cell differentiation
GO:0071840	0.355	cellular component organization or biogenesis
GO:0009605	0.333	response to external stimulus
GO:0006950	0.331	response to stress
GO:0016043	0.311	cellular component organization
GO:0050793	0.310	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0005634	0.959	nucleus
GO:0005576	0.884	extracellular region
GO:0070013	0.710	intracellular organelle lumen
GO:0009986	0.592	cell surface
GO:0030054	0.543	cell junction
GO:0005829	0.486	cytosol
GO:0031981	0.441	nuclear lumen
GO:0032991	0.383	protein-containing complex
GO:0005794	0.344	Golgi apparatus
GO:0005925	0.315	focal adhesion
GO:0031982	0.304	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]