StarFunc result for job id P09622

User Input

>input (509 residues)
MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCIEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
DKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTATKADGGTQVIDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKSINF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O08749	0.960	0.960	0.000	509	0.949	0.949	O08749.pdb.gz	DLDH_MOUSE Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dld PE=1 SV=2
2	AFDB:Q6TNU6	0.935	0.939	3.177E-98	507	0.831	0.834	Q6TNU6.pdb.gz
3	PDB:6hg8B	0.929	0.981	3.854E-96	482	0.929	0.981	6hg8B.pdb.gz	Crystal structure of the R460G disease-causing mutant of the human dihydrolipoamide dehydrogenase.
4	AFDB:Q9FEN7	0.913	0.922	2.343E-75	504	0.530	0.536	Q9FEN7.pdb.gz	Q9FEN7_SOLTU Dihydrolipoyl dehydrogenase OS=Solanum tuberosum OX=4113 GN=lpd2 PE=2 SV=1
5	AFDB:P09624	0.927	0.946	3.133E-75	499	0.540	0.551	P09624.pdb.gz	DLDH_YEAST Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LPD1 PE=1 SV=1
6	AFDB:Q9M5K2	0.915	0.918	4.190E-75	507	0.542	0.544	Q9M5K2.pdb.gz	DLDH2_ARATH Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPD2 PE=1 SV=1
7	AFDB:P31023	0.914	0.929	4.441E-75	501	0.540	0.549	P31023.pdb.gz	DLDH_PEA Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum OX=3888 GN=LPD PE=1 SV=2
8	AFDB:Q9SPB1	0.910	0.886	7.941E-75	523	0.546	0.532	Q9SPB1.pdb.gz	LEGRE_VIGUN Leghemoglobin reductase OS=Vigna unguiculata OX=3917 GN=FLBR PE=1 SV=1
9	AFDB:O00087	0.907	0.904	8.416E-75	511	0.554	0.552	O00087.pdb.gz	DLDH_SCHPO Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dld1 PE=2 SV=2
10	AFDB:Q59RQ6	0.914	0.948	5.100E-74	491	0.528	0.548	Q59RQ6.pdb.gz	Q59RQ6_CANAL Dihydrolipoyl dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LPD1 PE=3 SV=1
11	AFDB:Q54EW8	0.922	0.962	3.090E-73	488	0.538	0.561	Q54EW8.pdb.gz	DLDH_DICDI Dihydrolipoyl dehydrogenase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=lpd PE=3 SV=1
12	PDB:1jehA	0.911	0.970	7.263E-70	478	0.528	0.563	1jehA.pdb.gz	Crystal structure of eucaryotic E3, lipoamide dehydrogenase from yeast.
13	PDB:1dxlA	0.899	0.979	9.447E-66	467	0.527	0.574	1dxlA.pdb.gz	Interaction between the Lipoamide-Containing H-Protein and the Lipoamide Dehydrogenase (L-Protein) of the Glycine Decarboxylase Multienzyme System. 2. Crystal Structure of H- and L-Proteins
14	PDB:1ebdA	0.860	0.959	3.029E-57	455	0.395	0.442	1ebdA.pdb.gz	Protein-protein interactions in the pyruvate dehydrogenase multienzyme complex: dihydrolipoamide dehydrogenase complexed with the binding domain of dihydrolipoamide acetyltransferase.
15	PDB:4jdrA	0.863	0.931	4.550E-57	471	0.389	0.420	4jdrA.pdb.gz	Insight to the Interaction of the Dihydrolipoamide Acetyltransferase (E2) Core with the Peripheral Components in the Escherichia coli Pyruvate Dehydrogenase Complex via Multifaceted Structural Approaches.
16	PDB:7kmyA	0.884	0.966	3.309E-53	465	0.324	0.355	7kmyA.pdb.gz	Whole cell active inhibitors of mycobacterial lipoamide dehydrogenase afford selectivity over the human enzyme through tight binding interactions
17	PDB:3eanD	0.835	0.865	5.401E-44	491	0.261	0.271	3eanD.pdb.gz	Crystal structure and catalysis of the selenoprotein thioredoxin reductase 1.
18	PDB:3djjA	0.807	0.885	9.317E-43	462	0.257	0.284	3djjA.pdb.gz	Catalytic cycle of human glutathione reductase near 1 A resolution.
19	PDB:2hqmA	0.800	0.880	1.666E-42	461	0.257	0.284	2hqmA.pdb.gz	Crystal structure of glutathione reductase Glr1 from the yeast Saccharomyces cerevisiae.
20	PDB:1gerB	0.808	0.911	4.475E-42	449	0.248	0.281	1gerB.pdb.gz	Structure of glutathione reductase from Escherichia coli at 1.86 A resolution: comparison with the enzyme from human erythrocytes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00087	0.0	558	511	0.542	0.540	DLDH_SCHPO Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dld1 PE=2 SV=2
2	O08749	0.0	1003	509	0.949	0.949	DLDH_MOUSE Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Dld PE=1 SV=2
3	O81413	0.0	527	500	0.542	0.552	O81413_SOYBN Ferric leghemoglobin reductase-2 OS=Glycine max OX=3847 GN=547523 PE=2 SV=1
4	P09622	0.0	1043	509	1.000	1.000	DLDH_HUMAN Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2
5	P09624	0.0	539	499	0.534	0.545	DLDH_YEAST Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LPD1 PE=1 SV=1
6	P31023	0.0	538	501	0.540	0.549	DLDH_PEA Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum OX=3888 GN=LPD PE=1 SV=2
7	Q54EW8	0.0	523	488	0.507	0.529	DLDH_DICDI Dihydrolipoyl dehydrogenase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=lpd PE=3 SV=1
8	Q6P6R2	0.0	1003	509	0.947	0.947	DLDH_RAT Dihydrolipoyl dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Dld PE=1 SV=1
9	Q803L1	0.0	865	507	0.837	0.840	Q803L1_DANRE Dihydrolipoyl dehydrogenase OS=Danio rerio OX=7955 GN=fb24b05 PE=1 SV=1
10	Q9FEN7	0.0	522	504	0.501	0.506	Q9FEN7_SOLTU Dihydrolipoyl dehydrogenase OS=Solanum tuberosum OX=4113 GN=lpd2 PE=2 SV=1
11	Q9M5K2	0.0	524	507	0.532	0.535	DLDH2_ARATH Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPD2 PE=1 SV=1
12	Q9M5K3	0.0	539	507	0.556	0.558	DLDH1_ARATH Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPD1 PE=1 SV=2
13	Q9SPB1	0.0	526	523	0.544	0.530	LEGRE_VIGUN Leghemoglobin reductase OS=Vigna unguiculata OX=3917 GN=FLBR PE=1 SV=1
14	Q59RQ6	2.78e-164	476	491	0.511	0.530	Q59RQ6_CANAL Dihydrolipoyl dehydrogenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LPD1 PE=3 SV=1
15	Q04933	1.57e-155	453	479	0.462	0.491	DLDH_TRYBB Dihydrolipoyl dehydrogenase OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=1
16	P11959	4.26e-119	360	470	0.397	0.430	DLDH1_GEOSE Dihydrolipoyl dehydrogenase OS=Geobacillus stearothermophilus OX=1422 GN=pdhD PE=1 SV=2
17	P0A9P0	3.46e-113	345	474	0.389	0.418	DLDH_ECOLI Dihydrolipoyl dehydrogenase OS=Escherichia coli (strain K12) OX=83333 GN=lpdA PE=1 SV=2
18	Q5LRA7	3.20e-99	308	464	0.360	0.394	Q5LRA7_RUEPO Dihydrolipoyl dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=SPO2222 PE=3 SV=1
19	Q8I5A0	1.27e-93	296	512	0.375	0.373	Q8I5A0_PLAF7 Dihydrolipoyl dehydrogenase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1232200 PE=3 SV=2
20	Q02733	2.45e-83	268	499	0.318	0.325	IRC15_YEAST Increased recombination centers protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRC15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02737 3HCDH_N	7.3e+02	11.4	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
2	PF01262 AlaDh_PNT_C	0.036	24.9	Alanine dehydrogenase/PNT, C-terminal domain
3	PF01266 DAO	81	14.3	FAD dependent oxidoreductase
4	PF00890 FAD_binding_2	2.9e-05	35.0	FAD binding domain
5	PF01494 FAD_binding_3	0.34	21.7	FAD binding domain
6	PF12831 FAD_oxidored	2.6e-05	35.4	FAD dependent oxidoreductase
7	PF01134 GIDA	0.013	26.2	Glucose inhibited division protein A
8	PF03486 HI0933_like	0.4	21.0	HI0933-like protein
9	PF13434 Lys_Orn_oxgnase	4.2	18.0	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
10	PF06039 Mqo	2.9e+02	11.4	Malate:quinone oxidoreductase (Mqo)
11	PF13450 NAD_binding_8	0.00043	31.8	NAD(P)-binding Rossmann-like domain
12	PF00070 Pyr_redox	9.6e-15	66.2	Pyridine nucleotide-disulphide oxidoreductase
13	PF07992 Pyr_redox_2	2.1e-62	222.7	Pyridine nucleotide-disulphide oxidoreductase
14	PF13738 Pyr_redox_3	5.2e-05	34.2	Pyridine nucleotide-disulphide oxidoreductase
15	PF02852 Pyr_redox_dim	9e-39	143.5	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
16	PF01946 Thi4	3.6	18.3	Thi4 family
17	PF03721 UDPG_MGDP_dh_N	7e+02	11.2	UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000205402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227868	0.999	Pyruvate dehydrogenase protein X component, mitochondrial
2	9606.ENSP00000280346	0.999	Dihydrolipoamide S-acetyltransferase
3	9606.ENSP00000307241	0.999	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
4	9606.ENSP00000335304	0.999	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
5	9606.ENSP00000222673	0.998	2-oxoglutarate dehydrogenase, mitochondrial
6	9606.ENSP00000369134	0.998	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
7	9606.ENSP00000359151	0.997	Dihydrolipoamide branched chain transacylase E2
8	9606.ENSP00000318351	0.996	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
9	9606.ENSP00000269980	0.993	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial
10	9606.ENSP00000319531	0.990	Glycine cleavage system H protein, mitochondrial
11	9606.ENSP00000363216	0.990	2-oxoglutarate dehydrogenase-like, mitochondrial
12	9606.ENSP00000273588	0.989	Aminomethyltransferase, mitochondrial
13	9606.ENSP00000295266	0.988	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial
14	9606.ENSP00000370737	0.987	Glycine dehydrogenase (decarboxylating), mitochondrial
15	9606.ENSP00000367923	0.982	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
16	9606.ENSP00000327070	0.979	Malate dehydrogenase, mitochondrial
17	9606.ENSP00000377115	0.975	Lipoyltransferase 1, mitochondrial
18	9606.ENSP00000387536	0.975	[Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial
19	9606.ENSP00000309548	0.973	[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial
20	9606.ENSP00000263035	0.971	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016668	1.000	oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor
GO:0016903	0.997	oxidoreductase activity, acting on the aldehyde or oxo group of donors
GO:0005515	0.996	protein binding
GO:0004738	0.989	pyruvate dehydrogenase activity
GO:0016620	0.849	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:1901363	0.847	heterocyclic compound binding
GO:0097159	0.843	organic cyclic compound binding
GO:0043167	0.800	ion binding
GO:0036094	0.692	small molecule binding
GO:0004148	0.681	dihydrolipoyl dehydrogenase activity
GO:0015036	0.513	disulfide oxidoreductase activity
GO:0000166	0.492	nucleotide binding
GO:0043168	0.456	anion binding
GO:0140096	0.320	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0044281	0.976	small molecule metabolic process
GO:0006163	0.964	purine nucleotide metabolic process
GO:0009150	0.950	purine ribonucleotide metabolic process
GO:0043603	0.944	amide metabolic process
GO:0006082	0.941	organic acid metabolic process
GO:0033875	0.936	ribonucleoside bisphosphate metabolic process
GO:0034032	0.936	purine nucleoside bisphosphate metabolic process
GO:0009152	0.936	purine ribonucleotide biosynthetic process
GO:0019752	0.927	carboxylic acid metabolic process
GO:0006085	0.927	acetyl-CoA biosynthetic process
GO:0032787	0.852	monocarboxylic acid metabolic process
GO:0006090	0.762	pyruvate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:1902494	0.996	catalytic complex
GO:1990204	0.988	oxidoreductase complex
GO:0045240	0.949	dihydrolipoyl dehydrogenase complex
GO:0045254	0.946	pyruvate dehydrogenase complex
GO:0045252	0.940	oxoglutarate dehydrogenase complex
GO:0005634	0.926	nucleus
GO:0005759	0.896	mitochondrial matrix
GO:0098798	0.722	mitochondrial protein-containing complex
GO:0031982	0.371	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
EC:1.2.-.-	0.997	Acting on the aldehyde or oxo group of donors.
EC:1.2.1.-	0.849	With NAD(+) or NADP(+) as acceptor.
RHEA:15045	0.681	(R)-N(6)-dihydrolipoyl-L-lysyl-[protein] + NAD(+) = (R)-N(6)-lipoyl-L-lysyl-[protein] + H(+) + NADH
EC:1.8.1.4	0.681	dihydrolipoyl dehydrogenase.

[back to server]