StarFunc result for job id P09629

User Input

>input (217 residues)
MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYP
GGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
ESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQ
IKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09024	0.445	0.445	4.247E-28	217	0.940	0.940	P09024.pdb.gz	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
2	AFDB:P31268	0.453	0.431	7.655E-19	230	0.599	0.565	P31268.pdb.gz	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
3	AFDB:P09630	0.366	0.341	1.797E-12	235	0.401	0.370	P09630.pdb.gz	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
4	AFDB:P09016	0.348	0.298	1.061E-10	255	0.364	0.310	P09016.pdb.gz	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
5	AFDB:P13378	0.361	0.274	2.846E-10	290	0.387	0.290	P13378.pdb.gz	HXD8_HUMAN Homeobox protein Hox-D8 OS=Homo sapiens OX=9606 GN=HOXD8 PE=1 SV=2
6	AFDB:P09013	0.356	0.285	4.510E-10	276	0.392	0.308	P09013.pdb.gz	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
7	AFDB:P06798	0.335	0.257	1.681E-9	285	0.392	0.298	P06798.pdb.gz	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
8	AFDB:P09021	0.343	0.280	2.047E-9	270	0.359	0.289	P09021.pdb.gz	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
9	AFDB:A5PLE8	0.329	0.283	4.221E-9	255	0.309	0.263	A5PLE8.pdb.gz	A5PLE8_DANRE Caudal type homeobox 1 b OS=Danio rerio OX=7955 GN=zgc:165581 PE=2 SV=1
10	AFDB:Q99626	0.299	0.213	2.335E-8	313	0.373	0.259	Q99626.pdb.gz	CDX2_HUMAN Homeobox protein CDX-2 OS=Homo sapiens OX=9606 GN=CDX2 PE=1 SV=3
11	PDB:4egcA	0.232	0.094	5.858E-3	539	0.065	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.226	0.607	2.044E-2	73	0.078	0.233	2hi3A.pdb.gz
13	PDB:7fbyA	0.177	0.235	9.278E-1	153	0.037	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:2rvqD	0.089	0.119	1.377	129	0.097	0.163	2rvqD.pdb.gz
15	PDB:2cg4A	0.174	0.238	1.570	149	0.041	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:5aj0BZ	0.184	0.407	1.570	86	0.051	0.128	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:5nr5A	0.205	0.356	1.791	113	0.088	0.168	5nr5A.pdb.gz
18	PDB:5z56L	0.195	0.128	2.043	342	0.069	0.044	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
19	PDB:2cyyA	0.158	0.213	2.839	151	0.051	0.073	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
20	PDB:5mrca	0.157	0.186	2.839	177	0.060	0.073	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09629	4.67e-163	450	217	1.000	1.000	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
2	P09024	6.94e-147	409	217	0.899	0.899	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
3	P02830	1.94e-78	236	229	0.576	0.546	HXA7_MOUSE Homeobox protein Hox-A7 OS=Mus musculus OX=10090 GN=Hoxa7 PE=2 SV=2
4	P31268	2.52e-71	218	230	0.567	0.535	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
5	Q8AWZ0	8.51e-45	151	245	0.461	0.408	HXB8A_DANRE Homeobox protein Hox-B8a OS=Danio rerio OX=7955 GN=hoxb8a PE=2 SV=1
6	P02833	4.91e-43	150	378	0.323	0.185	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
7	P09023	3.97e-42	144	224	0.452	0.438	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
8	I3L3R1	4.70e-42	144	242	0.433	0.388	I3L3R1_HUMAN Homeobox B8 OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=1
9	P17509	1.29e-41	142	224	0.452	0.438	HXB6_HUMAN Homeobox protein Hox-B6 OS=Homo sapiens OX=9606 GN=HOXB6 PE=1 SV=4
10	P17481	2.14e-40	140	243	0.433	0.387	HXB8_HUMAN Homeobox protein Hox-B8 OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=2
11	P09632	4.89e-40	139	243	0.419	0.374	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
12	P09067	1.71e-38	135	269	0.276	0.223	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
13	P09079	1.82e-38	135	269	0.276	0.223	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
14	P09014	3.68e-38	135	275	0.276	0.218	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
15	P09013	4.93e-38	134	276	0.276	0.217	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
16	P31267	6.02e-38	133	233	0.295	0.275	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
17	P09092	6.39e-38	133	232	0.295	0.276	HXA6_MOUSE Homeobox protein Hox-A6 OS=Mus musculus OX=10090 GN=Hoxa6 PE=3 SV=2
18	P09021	1.86e-37	133	270	0.276	0.222	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
19	P20719	1.88e-37	133	270	0.276	0.222	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
20	P09630	1.90e-37	132	235	0.276	0.255	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09974 DUF2209	1.8e+02	13.8	Uncharacterized protein conserved in archaea (DUF2209)
2	PF05920 Homeobox_KN	3.7e+02	12.5	Homeobox KN domain
3	PF00046 Homeodomain	2.9e-18	76.8	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000239165

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352257	0.921	X-ray repair cross-complementing protein 6
2	9606.ENSP00000364190	0.921	Pre-B-cell leukemia transcription factor 2
3	9606.ENSP00000405890	0.902	Pre-B-cell leukemia transcription factor 1
4	9606.ENSP00000420009	0.894	Homeobox protein Hox-B6
5	9606.ENSP00000239151	0.875	Homeobox protein Hox-B5
6	9606.ENSP00000328928	0.867	Homeobox protein Hox-B4
7	9606.ENSP00000222726	0.859	Homeobox protein Hox-A5
8	9606.ENSP00000399808	0.852	Homeobox protein Hox-C4
9	9606.ENSP00000243108	0.844	Homeobox protein Hox-C6
10	9606.ENSP00000362588	0.841	Pre-B-cell leukemia transcription factor 3
11	9606.ENSP00000302548	0.832	Homeobox protein Hox-D4
12	9606.ENSP00000309336	0.829	Homeobox protein Hox-C5
13	9606.ENSP00000222728	0.826	Homeobox protein Hox-A6
14	9606.ENSP00000242159	0.826	Homeobox protein Hox-A7
15	9606.ENSP00000476742	0.809	Uncharacterized protein
16	9606.ENSP00000216797	0.780	NF-kappa-B inhibitor alpha
17	9606.ENSP00000272369	0.766	Homeobox protein Meis1
18	9606.ENSP00000313420	0.765	DNA-dependent protein kinase catalytic subunit
19	9606.ENSP00000304502	0.715	Homeobox protein SIX2
20	9606.ENSP00000453793	0.707	Homeobox protein Meis2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.998	protein binding
GO:0000981	0.996	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.986	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.858	DNA-binding transcription activator activity
GO:0001228	0.854	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.756	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0048856	0.986	anatomical structure development
GO:0019222	0.984	regulation of metabolic process
GO:0032501	0.980	multicellular organismal process
GO:0007275	0.944	multicellular organism development
GO:0060255	0.943	regulation of macromolecule metabolic process
GO:0048518	0.934	positive regulation of biological process
GO:0009889	0.931	regulation of biosynthetic process
GO:0080090	0.926	regulation of primary metabolic process
GO:0031323	0.926	regulation of cellular metabolic process
GO:0010468	0.925	regulation of gene expression
GO:0019219	0.917	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.906	regulation of DNA-templated transcription
GO:0048513	0.890	animal organ development
GO:0010604	0.867	positive regulation of macromolecule metabolic process
GO:0048522	0.863	positive regulation of cellular process
GO:0051173	0.833	positive regulation of nitrogen compound metabolic process
GO:0006357	0.782	regulation of transcription by RNA polymerase II
GO:0031325	0.780	positive regulation of cellular metabolic process
GO:0010557	0.766	positive regulation of macromolecule biosynthetic process
GO:0051254	0.766	positive regulation of RNA metabolic process
GO:0009987	0.757	cellular process
GO:0009790	0.756	embryo development
GO:0045893	0.749	positive regulation of DNA-templated transcription
GO:0048731	0.747	system development
GO:0045944	0.687	positive regulation of transcription by RNA polymerase II
GO:0009653	0.567	anatomical structure morphogenesis
GO:0048568	0.516	embryonic organ development
GO:0048519	0.341	negative regulation of biological process
GO:0048523	0.320	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.988	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]