StarFunc result for job id P09630

User Input

>input (235 residues)
MNSYFTNPSLSCHLAGGQDVLPNVALNSTAYDPVRHFSTYGAAVAQNRIYSTPFYSPQEN
VVFSSSRGPYDYGSNSFYQEKDMLSNCRQNTLGHNTQTSIAQDFSSEQGRTAPQDQKASI
QIYPWMQRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCL
TERQIKIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09630	1.000	1.000	8.170E-35	235	1.000	1.000	P09630.pdb.gz	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
2	AFDB:P31268	0.371	0.379	1.971E-13	230	0.387	0.396	P31268.pdb.gz	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
3	AFDB:Q68EH7	0.331	0.313	1.206E-11	250	0.349	0.328	Q68EH7.pdb.gz	HXC8A_DANRE Homeobox protein Hox-C8a OS=Danio rerio OX=7955 GN=hoxc8a PE=2 SV=1
4	AFDB:P32043	0.358	0.379	2.675E-11	222	0.328	0.347	P32043.pdb.gz	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3
5	AFDB:P06798	0.331	0.276	1.715E-10	285	0.340	0.281	P06798.pdb.gz	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
6	AFDB:Q8T940	0.347	0.324	1.958E-10	253	0.353	0.328	Q8T940.pdb.gz	UBX_JUNCO Homeotic protein ultrabithorax OS=Junonia coenia OX=39708 GN=Ubx PE=2 SV=1
7	AFDB:P09632	0.352	0.341	2.236E-10	243	0.332	0.321	P09632.pdb.gz	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
8	AFDB:Q8AWZ0	0.345	0.333	2.728E-10	245	0.345	0.331	Q8AWZ0.pdb.gz	HXB8A_DANRE Homeobox protein Hox-B8a OS=Danio rerio OX=7955 GN=hoxb8a PE=2 SV=1
9	AFDB:P09067	0.349	0.306	4.639E-10	269	0.349	0.305	P09067.pdb.gz	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
10	AFDB:P09014	0.365	0.316	5.661E-10	275	0.323	0.276	P09014.pdb.gz	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
11	PDB:4egcA	0.215	0.094	9.753E-3	539	0.064	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.203	0.586	2.639E-2	73	0.072	0.233	2hi3A.pdb.gz
13	PDB:5nr5A	0.167	0.318	7.782E-1	113	0.047	0.097	5nr5A.pdb.gz
14	PDB:7fbyA	0.157	0.228	1.238	153	0.030	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5aj0BZ	0.170	0.405	1.615	86	0.034	0.093	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:5mrca	0.149	0.192	2.105	177	0.055	0.073	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
17	PDB:2cg4A	0.154	0.225	2.250	149	0.043	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
18	PDB:2cyyA	0.142	0.202	2.569	151	0.051	0.079	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
19	PDB:2vbwA	0.109	0.169	2.745	147	0.043	0.068	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
20	PDB:4zzlA	0.104	0.166	2.934	146	0.038	0.062	4zzlA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09630	4.99e-180	494	235	1.000	1.000	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
2	P10629	4.99e-180	494	235	1.000	1.000	HXC6_MOUSE Homeobox protein Hox-C6 OS=Mus musculus OX=10090 GN=Hoxc6 PE=2 SV=2
3	P09092	1.57e-67	209	232	0.477	0.483	HXA6_MOUSE Homeobox protein Hox-A6 OS=Mus musculus OX=10090 GN=Hoxa6 PE=3 SV=2
4	P31267	4.91e-67	208	233	0.481	0.485	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
5	P09023	3.07e-60	191	224	0.468	0.491	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
6	P17509	4.53e-60	190	224	0.468	0.491	HXB6_HUMAN Homeobox protein Hox-B6 OS=Homo sapiens OX=9606 GN=HOXB6 PE=1 SV=4
7	P20719	2.42e-40	141	270	0.345	0.300	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
8	P09021	2.29e-39	139	270	0.272	0.237	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
9	P02830	6.07e-39	136	229	0.285	0.293	HXA7_MOUSE Homeobox protein Hox-A7 OS=Mus musculus OX=10090 GN=Hoxa7 PE=2 SV=2
10	P31268	8.24e-39	136	230	0.268	0.274	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
11	P09067	1.70e-38	136	269	0.281	0.245	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
12	P09079	1.74e-38	136	269	0.281	0.245	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
13	P52949	2.30e-38	135	233	0.336	0.339	HXA5_RAT Homeobox protein Hox-A5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hoxa5 PE=2 SV=1
14	P09013	3.42e-38	135	276	0.281	0.239	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
15	P09014	1.13e-37	134	275	0.268	0.229	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
16	P09024	1.34e-37	132	217	0.255	0.276	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
17	P09629	1.44e-37	132	217	0.255	0.276	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
18	P02833	1.73e-37	136	378	0.281	0.175	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
19	P32043	6.18e-37	131	222	0.255	0.270	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3
20	Q00444	9.70e-37	130	222	0.255	0.270	HXC5_HUMAN Homeobox protein Hox-C5 OS=Homo sapiens OX=9606 GN=HOXC5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	7.8e+02	11.4	Homeobox KN domain
2	PF00046 Homeodomain	1.2e-17	74.8	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000001759

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001757	0.722	Homeobox C5
2	60711.ENSCSAP00000001756	0.721	Homeobox C4
3	60711.ENSCSAP00000015514	0.703	Homeobox B4
4	60711.ENSCSAP00000010555	0.691	Homeobox D4
5	60711.ENSCSAP00000001765	0.687	Homeobox C10
6	60711.ENSCSAP00000015519	0.684	Homeobox B7
7	60711.ENSCSAP00000010416	0.683	Homeobox A5
8	60711.ENSCSAP00000010427	0.680	Homeobox A7
9	60711.ENSCSAP00000015515	0.678	Homeobox B5
10	60711.ENSCSAP00000015517	0.670	Homeobox B6
11	60711.ENSCSAP00000010418	0.666	Homeobox A6
12	60711.ENSCSAP00000009814	0.603	PBX homeobox 3
13	60711.ENSCSAP00000005571	0.555	PBX homeobox 2
14	60711.ENSCSAP00000001768	0.531	Homeobox C8
15	60711.ENSCSAP00000007778	0.529	Forkhead box P1
16	60711.ENSCSAP00000006900	0.526	PBX homeobox 1
17	60711.ENSCSAP00000014944	0.524	Heart and neural crest derivatives expressed 2
18	60711.ENSCSAP00000003649	0.519	Menin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0003700	0.997	DNA-binding transcription factor activity
GO:0005515	0.995	protein binding
GO:0000981	0.952	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.854	transcription cis-regulatory region binding
GO:0000977	0.835	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.541	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.533	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.510	DNA-binding transcription activator activity
GO:0001228	0.484	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.996	multicellular organism development
GO:0050794	0.988	regulation of cellular process
GO:0006355	0.978	regulation of DNA-templated transcription
GO:0048731	0.975	system development
GO:0006357	0.894	regulation of transcription by RNA polymerase II
GO:0009952	0.872	anterior/posterior pattern specification
GO:0048518	0.774	positive regulation of biological process
GO:0001501	0.760	skeletal system development
GO:0009987	0.754	cellular process
GO:0009790	0.738	embryo development
GO:0048522	0.693	positive regulation of cellular process
GO:0048513	0.660	animal organ development
GO:0009893	0.583	positive regulation of metabolic process
GO:0009792	0.576	embryo development ending in birth or egg hatching
GO:0031325	0.507	positive regulation of cellular metabolic process
GO:0010604	0.501	positive regulation of macromolecule metabolic process
GO:0045893	0.489	positive regulation of DNA-templated transcription
GO:0043009	0.473	chordate embryonic development
GO:0048706	0.395	embryonic skeletal system development
GO:0009653	0.381	anatomical structure morphogenesis
GO:0045944	0.356	positive regulation of transcription by RNA polymerase II
GO:0048519	0.338	negative regulation of biological process
GO:0048523	0.328	negative regulation of cellular process
GO:0030154	0.308	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.965	cytoplasm
GO:0005829	0.842	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]