StarFunc result for job id P09661

User Input

>input (255 residues)
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF
PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSI
LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT
FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09661	1.000	1.000	1.513E-49	255	1.000	1.000	P09661.pdb.gz	RU2A_HUMAN U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2
2	PDB:7a5pW	0.680	0.996	1.187E-31	174	0.675	0.989	7a5pW.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
3	AFDB:Q9BLB6	0.800	0.806	3.039E-29	253	0.451	0.455	Q9BLB6.pdb.gz	RU2A_CAEEL Probable U2 small nuclear ribonucleoprotein A' OS=Caenorhabditis elegans OX=6239 GN=mog-2 PE=1 SV=1
4	AFDB:P43333	0.679	0.695	2.624E-28	249	0.494	0.506	P43333.pdb.gz	RU2A_ARATH U2 small nuclear ribonucleoprotein A' OS=Arabidopsis thaliana OX=3702 GN=At1g09760 PE=2 SV=2
5	AFDB:Q9V4Q8	0.685	0.659	3.111E-28	265	0.525	0.506	Q9V4Q8.pdb.gz	RU2A_DROME Probable U2 small nuclear ribonucleoprotein A' OS=Drosophila melanogaster OX=7227 GN=U2A PE=1 SV=1
6	AFDB:Q9USX8	0.679	0.724	9.906E-27	239	0.404	0.431	Q9USX8.pdb.gz	RU2A_SCHPO U2 small nuclear ribonucleoprotein A' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lea1 PE=1 SV=1
7	PDB:3jb9j	0.626	0.997	6.563E-21	160	0.302	0.481	3jb9j.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
8	AFDB:Q388G6	0.619	0.491	5.478E-16	325	0.298	0.234	Q388G6.pdb.gz	Q388G6_TRYB2 U2 small nuclear ribonucleoprotein 40K OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2410 PE=3 SV=1
9	AFDB:Q08963	0.549	0.586	5.373E-12	238	0.227	0.244	Q08963.pdb.gz	RU2A_YEAST U2 small nuclear ribonucleoprotein A' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LEA1 PE=1 SV=1
10	PDB:5gmkb	0.516	0.969	6.252E-11	135	0.149	0.281	5gmkb.pdb.gz	Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
11	PDB:6g90W	0.602	0.896	8.303E-11	170	0.153	0.229	6g90W.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
12	AFDB:Q92688	0.430	0.437	8.377E-10	251	0.216	0.219	Q92688.pdb.gz	AN32B_HUMAN Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Homo sapiens OX=9606 GN=ANP32B PE=1 SV=1
13	AFDB:Q9VR52	0.583	0.384	1.246E-9	395	0.227	0.147	Q9VR52.pdb.gz	TILB_DROME Protein tilB OS=Drosophila melanogaster OX=7227 GN=tilB PE=1 SV=1
14	AFDB:Q9H069	0.432	0.224	1.751E-9	523	0.169	0.082	Q9H069.pdb.gz	DRC3_HUMAN Dynein regulatory complex subunit 3 OS=Homo sapiens OX=9606 GN=DRC3 PE=1 SV=2
15	PDB:6xzqG	0.449	0.703	1.907E-6	158	0.145	0.234	6xzqG.pdb.gz	Host ANP32A mediates the assembly of the influenza virus replicase.
16	PDB:6hkwA	0.393	0.332	6.278E-6	306	0.145	0.121	6hkwA.pdb.gz
17	PDB:1dceA	0.421	0.193	1.593E-4	567	0.129	0.058	1dceA.pdb.gz	Crystal structure of Rab geranylgeranyltransferase at 2.0 A resolution.
18	PDB:7p5vB	0.374	0.140	1.228E-3	732	0.118	0.041	7p5vB.pdb.gz
19	PDB:7tvfD	0.332	0.179	1.726E-3	515	0.118	0.058	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
20	PDB:7lt9A	0.268	0.272	1.827E-3	251	0.133	0.135	7lt9A.pdb.gz	Molecular basis for Ras suppressor-1 binding to PINCH-1 in focal adhesion assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09661	0.0	514	255	1.000	1.000	RU2A_HUMAN U2 small nuclear ribonucleoprotein A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=2
2	H0YKK0	1.74e-107	309	154	0.600	0.994	H0YKK0_HUMAN Small nuclear ribonucleoprotein polypeptide A' OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=1
3	H0YMA0	5.54e-91	266	142	0.518	0.930	H0YMA0_HUMAN Small nuclear ribonucleoprotein polypeptide A' (Fragment) OS=Homo sapiens OX=9606 GN=SNRPA1 PE=1 SV=1
4	Q9V4Q8	6.00e-81	246	265	0.514	0.494	RU2A_DROME Probable U2 small nuclear ribonucleoprotein A' OS=Drosophila melanogaster OX=7227 GN=U2A PE=1 SV=1
5	P43333	2.05e-77	236	249	0.498	0.510	RU2A_ARATH U2 small nuclear ribonucleoprotein A' OS=Arabidopsis thaliana OX=3702 GN=At1g09760 PE=2 SV=2
6	Q9BLB6	5.58e-75	230	253	0.451	0.455	RU2A_CAEEL Probable U2 small nuclear ribonucleoprotein A' OS=Caenorhabditis elegans OX=6239 GN=mog-2 PE=1 SV=1
7	Q9USX8	6.69e-61	194	239	0.396	0.423	RU2A_SCHPO U2 small nuclear ribonucleoprotein A' OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lea1 PE=1 SV=1
8	Q388G6	2.64e-24	101	325	0.247	0.194	Q388G6_TRYB2 U2 small nuclear ribonucleoprotein 40K OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2410 PE=3 SV=1
9	A0A087WWI0	6.51e-11	62.8	226	0.196	0.221	A0A087WWI0_HUMAN Leucine rich melanocyte differentiation associated OS=Homo sapiens OX=9606 GN=LRMDA PE=1 SV=1
10	Q9D5S7	9.18e-11	63.9	820	0.184	0.057	LRGUK_MOUSE Leucine-rich repeat and guanylate kinase domain-containing protein OS=Mus musculus OX=10090 GN=Lrguk PE=1 SV=1
11	Q5XJM1	2.08e-10	62.0	326	0.184	0.144	Q5XJM1_DANRE Leucine-rich repeat-containing protein 23 OS=Danio rerio OX=7955 GN=zgc:101782 PE=1 SV=1
12	Q9VQV7	2.25e-09	59.7	806	0.176	0.056	Q9VQV7_DROME Centrosomal protein 97kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cep97 PE=3 SV=3
13	Q9VR52	2.31e-09	59.3	395	0.208	0.134	TILB_DROME Protein tilB OS=Drosophila melanogaster OX=7227 GN=tilB PE=1 SV=1
14	Q582Q8	5.29e-09	58.2	383	0.188	0.125	Q582Q8_TRYB2 U2A'/phosphoprotein 32 family A C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.370 PE=4 SV=1
15	Q9NJE9	5.91e-09	58.2	383	0.188	0.125	DAA11_TRYBB Dynein axonemal assembly factor 11 OS=Trypanosoma brucei brucei OX=5702 GN=dnaaf11 PE=3 SV=1
16	A2AL36	1.40e-08	57.4	2334	0.153	0.017	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
17	A8IVX2	1.57e-08	57.0	524	0.180	0.088	DRC3_CHLRE Dynein regulatory complex subunit 3 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC3 PE=1 SV=1
18	Q9H2I8	1.94e-08	55.1	198	0.169	0.217	LRMDA_HUMAN Leucine-rich melanocyte differentiation-associated protein OS=Homo sapiens OX=9606 GN=LRMDA PE=1 SV=1
19	Q08C25	4.24e-08	53.9	181	0.165	0.232	Q08C25_DANRE Leucine-rich repeat-containing protein 51 OS=Danio rerio OX=7955 GN=zgc:153736 PE=1 SV=1
20	Q9H069	4.40e-08	55.8	523	0.184	0.090	DRC3_HUMAN Dynein regulatory complex subunit 3 OS=Homo sapiens OX=9606 GN=DRC3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12799 LRR_4	0.0034	29.0	Leucine Rich repeats (2 copies)
2	PF13855 LRR_8	0.015	26.3	Leucine rich repeat
3	PF14580 LRR_9	6.6e-94	323.9	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008569275.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008566126.1	0.999	U5 small nuclear ribonucleoprotein 200 kDa helicase
2	482537.XP_008567668.1	0.999	Splicing factor 3A subunit 3
3	482537.XP_008569582.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 9 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
4	482537.XP_008569749.1	0.999	pre-mRNA-processing factor 17
5	482537.XP_008572799.1	0.999	U2 small nuclear ribonucleoprotein B''
6	482537.XP_008576823.1	0.999	Small nuclear ribonucleoprotein Sm D2
7	482537.XP_008578821.1	0.999	pre-mRNA-splicing factor SYF1 isoform X1
8	482537.XP_008580536.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 18 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments
9	482537.XP_008583764.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 7 Proteins, and 82% coverage of the annotated genomic feature by RNAseq alignments
10	482537.XP_008586320.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 17 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008586738.1	0.999	Small nuclear ribonucleoprotein Sm D1
12	482537.XP_008566744.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 mRNAs, 13 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
13	482537.XP_008570871.1	0.998	Cell division cycle 5-like protein
14	482537.XP_008572365.1	0.998	PHD finger-like domain-containing protein 5A
15	482537.XP_008576529.1	0.998	116 kDa U5 small nuclear ribonucleoprotein component
16	482537.XP_008583829.1	0.998	pre-mRNA-processing factor 19
17	482537.XP_008588465.1	0.998	U4/U6.U5 tri-snRNP-associated protein 1
18	482537.XP_008589642.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	482537.XP_008590479.1	0.998	Small nuclear ribonucleoprotein E
20	482537.XP_008592281.1	0.998	Small nuclear ribonucleoprotein Sm D3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0016071	0.985	mRNA metabolic process
GO:0008380	0.985	RNA splicing
GO:0000398	0.984	mRNA splicing, via spliceosome
GO:0032501	0.742	multicellular organismal process
GO:0032502	0.733	developmental process
GO:0007283	0.516	spermatogenesis
GO:0065007	0.312	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990904	1.000	ribonucleoprotein complex
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005681	0.993	spliceosomal complex
GO:0016604	0.992	nuclear body
GO:0071013	0.977	catalytic step 2 spliceosome
GO:0005684	0.968	U2-type spliceosomal complex
GO:0016607	0.962	nuclear speck
GO:0071011	0.945	precatalytic spliceosome
GO:0030532	0.925	small nuclear ribonucleoprotein complex
GO:0071005	0.904	U2-type precatalytic spliceosome
GO:0097525	0.876	spliceosomal snRNP complex
GO:0005686	0.770	U2 snRNP
GO:0005737	0.760	cytoplasm
GO:0071007	0.656	U2-type catalytic step 2 spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]