StarFunc result for job id P09669

User Input

>input (75 residues)
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9B7	0.995	0.995	1.030E-11	75	1.000	1.000	A0A024R9B7.pdb.gz	A0A024R9B7_HUMAN Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:5z62I	0.862	0.883	1.788E-10	73	0.973	1.000	5z62I.pdb.gz	Structure of the intact 14-subunit human cytochrome c oxidase.
3	AFDB:P11951	0.975	0.963	8.019E-10	76	0.720	0.711	P11951.pdb.gz	CX6C2_RAT Cytochrome c oxidase subunit 6C-2 OS=Rattus norvegicus OX=10116 GN=Cox6c2 PE=1 SV=3
4	PDB:2dyrI	0.915	0.939	9.438E-9	73	0.720	0.740	2dyrI.pdb.gz	Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase
5	AFDB:P04038	0.837	0.848	2.456E-8	74	0.720	0.730	P04038.pdb.gz	COX6C_BOVIN Cytochrome c oxidase subunit 6C OS=Bos taurus OX=9913 GN=COX6C PE=1 SV=2
6	PDB:7o37i	0.840	0.872	7.705E-8	72	0.733	0.764	7o37i.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
7	AFDB:Q9VMS1	0.853	0.834	5.012E-5	77	0.400	0.390	Q9VMS1.pdb.gz	Q9VMS1_DROME Cyclope, isoform A OS=Drosophila melanogaster OX=7227 GN=cype PE=1 SV=3
8	AFDB:P73117	0.344	0.063	3.957	607	0.147	0.018	P73117.pdb.gz	P73117_SYNY3 Penicillin-binding protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=ftsI PE=1 SV=1
9	PDB:6ucjA	0.251	0.269	4.517	67	0.080	0.090	6ucjA.pdb.gz
10	AFDB:P28795	0.415	0.103	4.622	441	0.133	0.023	P28795.pdb.gz	PEX3_YEAST Peroxisomal biogenesis factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PEX3 PE=1 SV=1
11	AFDB:F1R1N9	0.426	0.080	5.400	657	0.173	0.020	F1R1N9.pdb.gz	F1R1N9_DANRE CD2-associated protein OS=Danio rerio OX=7955 GN=cd2apl PE=1 SV=1
12	AFDB:Q384A0	0.265	0.052	5.837	763	0.227	0.022	Q384A0.pdb.gz	Q384A0_TRYB2 Protein kinase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1050 PE=4 SV=1
13	AFDB:Q9BZL4	0.445	0.066	5.837	782	0.160	0.015	Q9BZL4.pdb.gz	PP12C_HUMAN Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C PE=1 SV=1
14	PDB:6lojB	0.466	0.085	6.166	571	0.107	0.014	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
15	AFDB:Q38F46	0.357	0.036	6.309	930	0.133	0.011	Q38F46.pdb.gz	Q38F46_TRYB2 Phosphodiesterase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3590 PE=3 SV=1
16	PDB:5apnb	0.307	0.390	6.664	58	0.120	0.155	5apnb.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
17	PDB:6elzt	0.243	0.085	7.786	290	0.200	0.052	6elzt.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
18	PDB:7o4hB	0.287	0.075	7.786	468	0.240	0.038	7o4hB.pdb.gz
19	PDB:5gm6G	0.263	0.042	9.831	875	0.120	0.010	5gm6G.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R9B7	1.99e-49	151	75	1.000	1.000	A0A024R9B7_HUMAN Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 PE=2 SV=1
2	P09669	1.99e-49	151	75	1.000	1.000	COX6C_HUMAN Cytochrome c oxidase subunit 6C OS=Homo sapiens OX=9606 GN=COX6C PE=1 SV=2
3	Q9CPQ1	4.47e-35	115	76	0.733	0.724	COX6C_MOUSE Cytochrome c oxidase subunit 6C OS=Mus musculus OX=10090 GN=Cox6c PE=1 SV=3
4	P11951	2.51e-34	113	76	0.720	0.711	CX6C2_RAT Cytochrome c oxidase subunit 6C-2 OS=Rattus norvegicus OX=10116 GN=Cox6c2 PE=1 SV=3
5	P04038	1.30e-33	111	74	0.720	0.730	COX6C_BOVIN Cytochrome c oxidase subunit 6C OS=Bos taurus OX=9913 GN=COX6C PE=1 SV=2
6	Q9VMS1	5.13e-13	59.7	77	0.400	0.390	Q9VMS1_DROME Cyclope, isoform A OS=Drosophila melanogaster OX=7227 GN=cype PE=1 SV=3
7	Q9VN25	4.4	27.7	1140	0.213	0.014	EIF3A_DROME Eukaryotic translation initiation factor 3 subunit A OS=Drosophila melanogaster OX=7227 GN=eIF3a PE=1 SV=1
8	E7F6T8	6.2	26.9	937	0.133	0.011	UBP37_DANRE Ubiquitin carboxyl-terminal hydrolase 37 OS=Danio rerio OX=7955 GN=usp37 PE=2 SV=1
9	Q95TJ9	7.9	26.9	566	0.200	0.027	CYCG_DROME Cyclin G OS=Drosophila melanogaster OX=7227 GN=CycG PE=1 SV=1
10	Q5JRM2	8.0	26.6	361	0.147	0.030	CX066_HUMAN Uncharacterized protein CXorf66 OS=Homo sapiens OX=9606 GN=CXorf66 PE=1 SV=1
11	P38652	8.6	26.6	562	0.200	0.027	PGM1_RAT Phosphoglucomutase-1 OS=Rattus norvegicus OX=10116 GN=Pgm1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02937 COX6C	3.7e-32	121.5	Cytochrome c oxidase subunit VIc

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246554	0.999	Cytochrome c oxidase subunit 6B1
2	9606.ENSP00000258424	0.999	Cytochrome c oxidase subunit 5B, mitochondrial
3	9606.ENSP00000317780	0.999	Cytochrome c oxidase subunit 5A, mitochondrial
4	9606.ENSP00000354876	0.999	Cytochrome c oxidase subunit 2
5	9606.ENSP00000425759	0.999	Cytochrome c oxidase subunit 7C, mitochondrial
6	9606.ENSP00000457513	0.999	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
7	9606.ENSP00000229379	0.998	Cytochrome c oxidase subunit 6A1, mitochondrial
8	9606.ENSP00000287490	0.998	Cytochrome c oxidase subunit 6A2, mitochondrial
9	9606.ENSP00000359098	0.994	Cytochrome c oxidase subunit 7A2, mitochondrial
10	9606.ENSP00000339720	0.993	Cytochrome c oxidase subunit NDUFA4
11	9606.ENSP00000417656	0.992	Cytochrome c oxidase subunit 7B, mitochondrial
12	9606.ENSP00000367939	0.991	Cytochrome b-c1 complex subunit 8
13	9606.ENSP00000321260	0.989	Cytochrome c oxidase subunit 8A, mitochondrial
14	9606.ENSP00000354499	0.984	Cytochrome c oxidase subunit 1
15	9606.ENSP00000301587	0.982	ATP synthase subunit d, mitochondrial
16	9606.ENSP00000307786	0.981	Cytochrome c
17	9606.ENSP00000243997	0.979	ATP synthase subunit epsilon, mitochondrial
18	9606.ENSP00000358840	0.976	Up-regulated during skeletal muscle growth protein 5
19	9606.ENSP00000292475	0.975	ATP synthase subunit f, mitochondrial
20	9606.ENSP00000467266	0.975	Cytochrome c oxidase subunit 6B2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.985	catalytic activity
GO:0022857	0.909	transmembrane transporter activity
GO:0016491	0.842	oxidoreductase activity
GO:0009055	0.808	electron transfer activity
GO:0015453	0.795	oxidoreduction-driven active transmembrane transporter activity
GO:0015078	0.765	proton transmembrane transporter activity
GO:0016675	0.575	oxidoreductase activity, acting on a heme group of donors
GO:0022853	0.552	active monoatomic ion transmembrane transporter activity
GO:0004129	0.543	cytochrome-c oxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.994	cellular metabolic process
GO:0006091	0.980	generation of precursor metabolites and energy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005739	0.998	mitochondrion
GO:0031967	0.995	organelle envelope
GO:0032991	0.975	protein-containing complex
GO:0098800	0.963	inner mitochondrial membrane protein complex
GO:0005746	0.960	mitochondrial respirasome
GO:0098803	0.872	respiratory chain complex
GO:1902494	0.787	catalytic complex
GO:0045277	0.525	respiratory chain complex IV
GO:0005751	0.456	mitochondrial respiratory chain complex IV

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.842	Oxidoreductases.
EC:7.-.-.-	0.795	Translocases.
EC:1.9.-.-	0.575	Acting on a heme group of donors.
RHEA:11436	0.543	4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O
EC:7.1.1.9	0.543	cytochrome-c oxidase.

[back to server]