StarFunc result for job id P09769

User Input

>input (529 residues)
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQA
INPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09769	1.000	1.000	1.457E-99	529	1.000	1.000	P09769.pdb.gz	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
2	AFDB:P14234	0.866	0.886	1.031E-86	517	0.839	0.859	P14234.pdb.gz	FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus OX=10090 GN=Fgr PE=1 SV=2
3	AFDB:A5WWJ6	0.931	0.933	2.167E-77	528	0.701	0.703	A5WWJ6.pdb.gz
4	AFDB:A1A5H8	0.857	0.830	1.525E-76	546	0.690	0.668	A1A5H8.pdb.gz	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
5	AFDB:F1RDG9	0.852	0.829	3.738E-76	544	0.709	0.689	F1RDG9.pdb.gz	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	AFDB:F1NQU9	0.835	0.827	1.326E-75	534	0.715	0.708	F1NQU9.pdb.gz	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
7	AFDB:Q1JPZ3	0.850	0.842	4.459E-75	534	0.647	0.640	Q1JPZ3.pdb.gz	SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio OX=7955 GN=src PE=1 SV=2
8	AFDB:J3QRU1	0.837	0.808	6.923E-74	548	0.698	0.673	J3QRU1.pdb.gz	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
9	AFDB:E1BIM8	0.850	0.654	3.196E-73	688	0.671	0.516	E1BIM8.pdb.gz	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
10	AFDB:P08103	0.839	0.846	1.958E-68	524	0.556	0.561	P08103.pdb.gz	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
11	PDB:2h8hA	0.824	0.978	1.154E-66	445	0.628	0.746	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.474	0.562	1.752E-37	441	0.340	0.408	1k9aB.pdb.gz
13	PDB:4fl2A	0.476	0.454	4.017E-29	555	0.244	0.232	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.456	0.439	8.873E-26	551	0.229	0.220	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:4krcA	0.412	0.705	4.818E-16	297	0.140	0.249	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:7mfdA	0.421	0.535	1.245E-15	410	0.185	0.239	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
17	PDB:6s73A	0.424	0.807	1.312E-15	269	0.119	0.234	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:1unlA	0.404	0.697	4.905E-15	292	0.125	0.226	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:5ufuA	0.406	0.568	8.762E-15	369	0.147	0.211	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
20	PDB:8dksA	0.381	0.682	1.336E-14	283	0.149	0.279	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1A5H8	753	546	0.699	0.678	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
2	E1BIM8	729	688	0.665	0.512	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
3	F1LM93	750	541	0.682	0.667	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
4	F1NQU9	786	534	0.728	0.721	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
5	F1RDG9	771	544	0.715	0.695	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	H0Y3C5	593	525	0.550	0.554	H0Y3C5_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	J3KPD6	592	526	0.550	0.553	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
8	J3QRU1	762	548	0.688	0.664	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
9	P00523	725	533	0.662	0.657	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
10	P05480	729	535	0.669	0.662	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
11	P06239	560	509	0.509	0.528	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
12	P06240	558	509	0.505	0.525	LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4
13	P06241	771	537	0.720	0.709	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
14	P07947	762	543	0.688	0.670	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
15	P07948	564	512	0.514	0.531	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
16	P08103	589	524	0.565	0.571	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
17	P08631	593	526	0.550	0.553	HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5
18	P09324	762	541	0.709	0.693	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
19	P09769	1106	529	1.000	1.000	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
20	P12931	722	536	0.673	0.664	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	17	16.0	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	72	13.8	Haspin like kinase domain
3	PF00069 Pkinase	9.4e-38	141.7	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	1e-85	298.7	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	9e-25	97.9	SH2 domain
6	PF00018 SH3_1	7.7e-16	68.8	SH3 domain
7	PF17902 SH3_10	7.9	17.9	SH3 domain
8	PF07653 SH3_2	5e-07	40.8	Variant SH3 domain
9	PF14604 SH3_9	2.9e-07	41.6	Variant SH3 domain
10	PF17978 zf-RING_14	37	16.1	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363117

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.992	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000444986	0.971	Tyrosine-protein kinase HCK
3	9606.ENSP00000275493	0.968	Epidermal growth factor receptor
4	9606.ENSP00000364907	0.967	Tyrosine-protein kinase SYK
5	9606.ENSP00000356946	0.959	Low affinity immunoglobulin gamma Fc region receptor III-A
6	9606.ENSP00000264657	0.956	Signal transducer and activator of transcription 3
7	9606.ENSP00000394049	0.954	Src-like-adapter
8	9606.ENSP00000233668	0.953	Docking protein 1
9	9606.ENSP00000267257	0.945	Paxillin
10	9606.ENSP00000462468	0.945	Tyrosine-protein kinase Yes
11	9606.ENSP00000358165	0.944	High affinity immunoglobulin gamma Fc receptor I
12	9606.ENSP00000271450	0.942	Low affinity immunoglobulin gamma Fc region receptor II-a
13	9606.ENSP00000256935	0.940	Dedicator of cytokinesis protein 2
14	9606.ENSP00000224337	0.939	B-cell linker protein
15	9606.ENSP00000482259	0.939	C-C motif chemokine 4
16	9606.ENSP00000483570	0.939	Tyrosine-protein kinase BTK
17	9606.ENSP00000295683	0.938	C-X-C chemokine receptor type 1
18	9606.ENSP00000365891	0.938	Wiskott-Aldrich syndrome protein
19	9606.ENSP00000407586	0.936	GTPase HRas
20	9606.ENSP00000341189	0.935	Focal adhesion kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0005102	0.942	signaling receptor binding
GO:0019899	0.888	enzyme binding
GO:0051219	0.808	phosphoprotein binding
GO:0001784	0.770	phosphotyrosine residue binding
GO:0019900	0.764	kinase binding
GO:0004715	0.746	non-membrane spanning protein tyrosine kinase activity
GO:0019901	0.597	protein kinase binding
GO:0044877	0.389	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.988	response to stimulus
GO:0050794	0.987	regulation of cellular process
GO:0007154	0.980	cell communication
GO:0051716	0.976	cellular response to stimulus
GO:0007165	0.969	signal transduction
GO:0048583	0.964	regulation of response to stimulus
GO:0071704	0.937	organic substance metabolic process
GO:0044237	0.929	cellular metabolic process
GO:0048518	0.922	positive regulation of biological process
GO:0016310	0.903	phosphorylation
GO:0044238	0.902	primary metabolic process
GO:0006468	0.885	protein phosphorylation
GO:0048522	0.850	positive regulation of cellular process
GO:0050776	0.836	regulation of immune response
GO:0007166	0.779	cell surface receptor signaling pathway
GO:0019222	0.761	regulation of metabolic process
GO:0018212	0.737	peptidyl-tyrosine modification
GO:0002376	0.706	immune system process
GO:0032501	0.696	multicellular organismal process
GO:0048584	0.584	positive regulation of response to stimulus
GO:0032502	0.534	developmental process
GO:0002684	0.513	positive regulation of immune system process
GO:0060255	0.494	regulation of macromolecule metabolic process
GO:0031323	0.491	regulation of cellular metabolic process
GO:0080090	0.462	regulation of primary metabolic process
GO:0065009	0.455	regulation of molecular function
GO:0051171	0.455	regulation of nitrogen compound metabolic process
GO:0051239	0.447	regulation of multicellular organismal process
GO:0023051	0.446	regulation of signaling
GO:0010646	0.444	regulation of cell communication
GO:0010604	0.442	positive regulation of macromolecule metabolic process
GO:0048519	0.441	negative regulation of biological process
GO:0042221	0.437	response to chemical
GO:0009966	0.432	regulation of signal transduction
GO:0048856	0.423	anatomical structure development
GO:0002764	0.420	immune response-regulating signaling pathway
GO:0006950	0.405	response to stress
GO:0010468	0.398	regulation of gene expression
GO:0048523	0.395	negative regulation of cellular process
GO:0002768	0.389	immune response-regulating cell surface receptor signaling pathway
GO:0050778	0.376	positive regulation of immune response
GO:0070887	0.369	cellular response to chemical stimulus
GO:0018108	0.366	peptidyl-tyrosine phosphorylation
GO:0051174	0.345	regulation of phosphorus metabolic process
GO:0050790	0.331	regulation of catalytic activity
GO:0042325	0.326	regulation of phosphorylation
GO:0009605	0.321	response to external stimulus
GO:0031399	0.315	regulation of protein modification process
GO:0031325	0.313	positive regulation of cellular metabolic process
GO:1902531	0.312	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0043226	0.939	organelle
GO:0043229	0.916	intracellular organelle
GO:0043227	0.894	membrane-bounded organelle
GO:0043231	0.829	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.746	non-specific protein-tyrosine kinase.

[back to server]