StarFunc result for job id P09848

User Input

>input (1927 residues)
MELSWHVVFIALLSFSCWGSDWESDRNFISTAGPLTNDLLHNLSGLLGDQSSNFVAGDKD
MYVCHQPLPTFLPEYFSSLHASQITHYKVFLSWAQLLPAGSTQNPDEKTVQCYRRLLKAL
KTARLQPMVILHHQTLPASTLRRTEAFADLFADYATFAFHSFGDLVGIWFTFSDLEEVIK
ELPHQESRASQLQTLSDAHRKAYEIYHESYAFQGGKLSVVLRAEDIPELLLEPPISALAQ
DTVDFLSLDLSYECQNEASLRQKLSKLQTIEPKVKVFIFNLKLPDCPSTMKNPASLLFSL
FEAINKDQVLTIGFDINEFLSCSSSSKKSMSCSLTGSLALQPDQQQDHETTDSSPASAYQ
RIWEAFANQSRAERDAFLQDTFPEGFLWGASTGAFNVEGGWAEGGRGVSIWDPRRPLNTT
EGQATLEVASDSYHKVASDVALLCGLRAQVYKFSISWSRIFPMGHGSSPSLPGVAYYNKL
IDRLQDAGIEPMATLFHWDLPQALQDHGGWQNESVVDAFLDYAAFCFSTFGDRVKLWVTF
HEPWVMSYAGYGTGQHPPGISDPGVASFKVAHLVLKAHARTWHHYNSHHRPQQQGHVGIV
LNSDWAEPLSPERPEDLRASERFLHFMLGWFAHPVFVDGDYPATLRTQIQQMNRQCSHPV
AQLPEFTEAEKQLLKGSADFLGLSHYTSRLISNAPQNTCIPSYDTIGGFSQHVNHVWPQT
SSSWIRVVPWGIRRLLQFVSLEYTRGKVPIYLAGNGMPIGESENLFDDSLRVDYFNQYIN
EVLKAIKEDSVDVRSYIARSLIDGFEGPSGYSQRFGLHHVNFSDSSKSRTPRKSAYFFTS
IIEKNGFLTKGAKRLLPPNTVNLPSKVRAFTFPSEVPSKAKVVWEKFSSQPKFERDLFYH
GTFRDDFLWGVSSSAYQIEGAWDADGKGPSIWDNFTHTPGSNVKDNATGDIACDSYHQLD
ADLNMLRALKVKAYRFSISWSRIFPTGRNSSINSHGVDYYNRLINGLVASNIFPMVTLFH
WDLPQALQDIGGWENPALIDLFDSYADFCFQTFGDRVKFWMTFNEPMYLAWLGYGSGEFP
PGVKDPGWAPYRIAHAVIKAHARVYHTYDEKYRQEQKGVISLSLSTHWAEPKSPGVPRDV
EAADRMLQFSLGWFAHPIFRNGDYPDTMKWKVGNRSELQHLATSRLPSFTEEEKRFIRAT
ADVFCLNTYYSRIVQHKTPRLNPPSYEDDQEMAEEEDPSWPSTAMNRAAPWGTRRLLNWI
KEEYGDIPIYITENGVGLTNPNTEDTDRIFYHKTYINEALKAYRLDGIDLRGYVAWSLMD
NFEWLNGYTVKFGLYHVDFNNTNRPRTARASARYYTEVITNNGMPLAREDEFLYGRFPEG
FIWSAASAAYQIEGAWRADGKGLSIWDTFSHTPLRVENDAIGDVACDSYHKIAEDLVTLQ
NLGVSHYRFSISWSRILPDGTTRYINEAGLNYYVRLIDTLLAASIQPQVTIYHWDLPQTL
QDVGGWENETIVQRFKEYADVLFQRLGDKVKFWITLNEPFVIAYQGYGYGTAAPGVSNRP
GTAPYIVGHNLIKAHAEAWHLYNDVYRASQGGVISITISSDWAEPRDPSNQEDVEAARRY
VQFMGGWFAHPIFKNGDYNEVMKTRIRDRSLAAGLNKSRLPEFTESEKRRINGTYDFFGF
NHYTTVLAYNLNYATAISSFDADRGVASIADRSWPDSGSFWLKMTPFGFRRILNWLKEEY
NDPPIYVTENGVSQREETDLNDTARIYYLRTYINEALKAVQDKVDLRGYTVWSAMDNFEW
ATGFSERFGLHFVNYSDPSLPRIPKASAKFYASVVRCNGFPDPATGPHACLHQPDAGPTI
SPVRQEEVQFLGLMLGTTEAQTALYVLFSLVLLGVCGLAFLSYKYCKRSKQGKTQRSQQE
LSPVSSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09848	1.000	1.000	0.000	1927	1.000	1.000	P09848.pdb.gz	LPH_HUMAN Lactase/phlorizin hydrolase OS=Homo sapiens OX=9606 GN=LCT PE=1 SV=3
2	AFDB:P09849	0.544	0.545	0.000	1926	0.826	0.826	P09849.pdb.gz	LPH_RABIT Lactase/phlorizin hydrolase OS=Oryctolagus cuniculus OX=9986 GN=LCT PE=1 SV=1
3	AFDB:Q02401	0.558	0.557	0.000	1928	0.779	0.779	Q02401.pdb.gz	LPH_RAT Lactase/phlorizin hydrolase OS=Rattus norvegicus OX=10116 GN=Lct PE=1 SV=2
4	AFDB:Q99N32	0.426	0.768	1.171E-80	1043	0.191	0.354	Q99N32.pdb.gz	KLOTB_MOUSE Beta-klotho OS=Mus musculus OX=10090 GN=Klb PE=1 SV=1
5	AFDB:O35082	0.424	0.784	4.906E-79	1014	0.196	0.373	O35082.pdb.gz	KLOT_MOUSE Klotho OS=Mus musculus OX=10090 GN=Kl PE=1 SV=2
6	AFDB:Q9UEF7	0.423	0.780	9.882E-79	1012	0.201	0.383	Q9UEF7.pdb.gz	KLOT_HUMAN Klotho OS=Homo sapiens OX=9606 GN=KL PE=1 SV=2
7	AFDB:Q86Z14	0.418	0.745	6.300E-77	1044	0.189	0.350	Q86Z14.pdb.gz	KLOTB_HUMAN Beta-klotho OS=Homo sapiens OX=9606 GN=KLB PE=1 SV=1
8	PDB:5vanA	0.408	0.876	2.967E-75	861	0.184	0.411	5vanA.pdb.gz	Structures of beta-klotho reveal a 'zip code'-like mechanism for endocrine FGF signalling.
9	AFDB:Q8K1F9	0.247	0.832	7.115E-54	566	0.121	0.413	Q8K1F9.pdb.gz	LCTL_MOUSE Lactase-like protein OS=Mus musculus OX=10090 GN=Lctl PE=1 SV=1
10	AFDB:Q9H227	0.240	0.981	1.868E-52	469	0.115	0.471	Q9H227.pdb.gz	GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens OX=9606 GN=GBA3 PE=1 SV=2
11	PDB:2e9lA	0.239	0.978	3.919E-50	466	0.115	0.474	2e9lA.pdb.gz	Klotho-related protein is a novel cytosolic neutral beta-glycosylceramidase.
12	AFDB:Q9FIW4	0.231	0.895	2.853E-46	490	0.101	0.398	Q9FIW4.pdb.gz	BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=1 SV=1
13	PDB:3u57A	0.226	0.914	7.674E-45	471	0.107	0.437	3u57A.pdb.gz	Structures of alkaloid biosynthetic glucosidases decode substrate specificity.
14	PDB:7f3aA	0.228	0.906	2.972E-44	477	0.101	0.409	7f3aA.pdb.gz
15	PDB:3ahvA	0.226	0.910	1.647E-42	472	0.091	0.373	3ahvA.pdb.gz	The structural basis of oligosaccharide binding by rice BGlu1 beta-glucosidase
16	PDB:2e3zA	0.225	0.928	8.842E-42	460	0.104	0.437	2e3zA.pdb.gz
17	PDB:3ahyB	0.225	0.911	4.974E-41	466	0.102	0.423	3ahyB.pdb.gz	Structural and functional analysis of three beta-glucosidases from bacterium Clostridium cellulovorans, fungus Trichoderma reesei and termite Neotermes koshunensis
18	PDB:2jf6B	0.227	0.909	6.583E-41	472	0.092	0.375	2jf6B.pdb.gz	Molecular Architecture of Strictosidine Glucosidase - the Gateway to the Biosynthesis of the Monoterpenoid Indole Alkaloid Family
19	PDB:1e1eB	0.230	0.874	1.004E-37	495	0.089	0.347	1e1eB.pdb.gz
20	PDB:2xhyA	0.212	0.815	6.137E-27	470	0.066	0.270	2xhyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35082	0.0	629	1014	0.197	0.374	KLOT_MOUSE Klotho OS=Mus musculus OX=10090 GN=Kl PE=1 SV=2
2	P09848	0.0	4011	1927	1.000	1.000	LPH_HUMAN Lactase/phlorizin hydrolase OS=Homo sapiens OX=9606 GN=LCT PE=1 SV=3
3	P09849	0.0	3353	1926	0.827	0.827	LPH_RABIT Lactase/phlorizin hydrolase OS=Oryctolagus cuniculus OX=9986 GN=LCT PE=1 SV=1
4	Q02401	0.0	3108	1928	0.780	0.780	LPH_RAT Lactase/phlorizin hydrolase OS=Rattus norvegicus OX=10116 GN=Lct PE=1 SV=2
5	Q86Z14	0.0	637	1044	0.194	0.358	KLOTB_HUMAN Beta-klotho OS=Homo sapiens OX=9606 GN=KLB PE=1 SV=1
6	Q99N32	0.0	632	1043	0.198	0.365	KLOTB_MOUSE Beta-klotho OS=Mus musculus OX=10090 GN=Klb PE=1 SV=1
7	Q9UEF7	0.0	634	1012	0.195	0.371	KLOT_HUMAN Klotho OS=Homo sapiens OX=9606 GN=KL PE=1 SV=2
8	Q9Z2Y9	0.0	578	1014	0.189	0.359	KLOT_RAT Klotho OS=Rattus norvegicus OX=10116 GN=Kl PE=1 SV=1
9	W5PLZ6	0.0	3374	1931	0.835	0.834	LPH_SHEEP Lactase/phlorizin hydrolase OS=Ovis aries OX=9940 GN=LCT PE=1 SV=1
10	Q8K1F9	6.40e-146	466	566	0.121	0.412	LCTL_MOUSE Lactase-like protein OS=Mus musculus OX=10090 GN=Lctl PE=1 SV=1
11	Q9H227	4.47e-142	451	469	0.112	0.461	GBA3_HUMAN Cytosolic beta-glucosidase OS=Homo sapiens OX=9606 GN=GBA3 PE=1 SV=2
12	Q8L7J2	5.83e-117	383	521	0.109	0.403	BGL06_ORYSJ Beta-glucosidase 6 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU6 PE=1 SV=1
13	Q9FZE0	2.30e-116	381	510	0.108	0.410	BGL40_ARATH Beta-glucosidase 40 OS=Arabidopsis thaliana OX=3702 GN=BGLU40 PE=2 SV=1
14	Q9FIW4	6.87e-114	373	490	0.101	0.398	BGL42_ARATH Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=1 SV=1
15	Q9LU02	9.77e-104	345	507	0.099	0.377	BGL13_ARATH Beta-glucosidase 13 OS=Arabidopsis thaliana OX=3702 GN=BGLU13 PE=2 SV=1
16	Q75I93	3.09e-103	343	504	0.101	0.385	BGL07_ORYSJ Beta-glucosidase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU7 PE=1 SV=1
17	Q8GVD0	5.15e-103	344	551	0.102	0.358	BGLC_OLEEU Oleuropein beta-glucosidase OS=Olea europaea OX=4146 GN=GLU PE=1 SV=1
18	Q9SPP9	6.90e-103	343	540	0.109	0.391	RG1_RAUSE Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
19	O93785	1.33e-102	340	466	0.104	0.431	O93785_HYPJE Beta-glucosidase OS=Hypocrea jecorina OX=51453 GN=bgl2 PE=1 SV=1
20	Q93ZI4	5.74e-102	340	508	0.101	0.382	BGL10_ARATH Beta-glucosidase 10 OS=Arabidopsis thaliana OX=3702 GN=BGLU10 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00232 Glyco_hydro_1	0	1878.3	Glycosyl hydrolase family 1
2	PF00331 Glyco_hydro_10	23	15.6	Glycosyl hydrolase family 10

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264162

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306920	0.944	Beta-galactosidase
2	9606.ENSP00000272252	0.941	Aldose 1-epimerase
3	9606.ENSP00000269097	0.925	Glucose-6-phosphatase 3
4	9606.ENSP00000253801	0.919	Glucose-6-phosphatase
5	9606.ENSP00000364512	0.919	Glucose-6-phosphatase 2
6	9606.ENSP00000301046	0.918	Alpha-lactalbumin
7	9606.ENSP00000223366	0.909	Glucokinase
8	9606.ENSP00000285930	0.909	Aldose reductase
9	9606.ENSP00000218516	0.906	Galactosidase alpha
10	9606.ENSP00000292432	0.905	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
11	9606.ENSP00000290573	0.903	Hexokinase-2
12	9606.ENSP00000346643	0.903	Putative hexokinase HKDC1
13	9606.ENSP00000369055	0.903	Beta-1,4-galactosyltransferase 1
14	9606.ENSP00000402103	0.903	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
15	9606.ENSP00000352584	0.902	Aldo-keto reductase family 1 member B10
16	9606.ENSP00000310696	0.900	Beta-1,4-galactosyltransferase 2
17	9606.ENSP00000252997	0.817	Transcription factor GATA-5
18	9606.ENSP00000330484	0.753	Belongs to the glycosyl hydrolase 13 family
19	9606.ENSP00000359096	0.753	Amylase, alpha 1C
20	9606.ENSP00000359100	0.753	Amylase, alpha 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008422	1.000	beta-glucosidase activity
GO:0005515	0.984	protein binding
GO:0000016	0.356	lactase activity
GO:0042802	0.353	identical protein binding
GO:0046983	0.302	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0016052	0.941	carbohydrate catabolic process
GO:0044237	0.933	cellular metabolic process
GO:0009311	0.917	oligosaccharide metabolic process
GO:0009313	0.888	oligosaccharide catabolic process
GO:0044248	0.717	cellular catabolic process
GO:0044275	0.697	cellular carbohydrate catabolic process
GO:0005984	0.691	disaccharide metabolic process
GO:0046352	0.656	disaccharide catabolic process
GO:0006807	0.464	nitrogen compound metabolic process
GO:0050896	0.415	response to stimulus
GO:1901564	0.349	organonitrogen compound metabolic process
GO:0065007	0.334	biological regulation
GO:0050789	0.314	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.985	membrane
GO:0005886	0.983	plasma membrane
GO:0043226	0.796	organelle
GO:0043227	0.787	membrane-bounded organelle
GO:0005622	0.786	intracellular anatomical structure
GO:0005737	0.741	cytoplasm
GO:0043229	0.722	intracellular organelle
GO:0043231	0.708	intracellular membrane-bounded organelle
GO:0098590	0.699	plasma membrane region
GO:0045177	0.551	apical part of cell
GO:0016324	0.540	apical plasma membrane
GO:0009986	0.454	cell surface
GO:0098552	0.426	side of membrane
GO:0098862	0.347	cluster of actin-based cell projections
GO:0009897	0.302	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.21	1.000	beta-glucosidase.
RHEA:10076	0.356	H2O + lactose = beta-D-galactose + D-glucose
EC:3.2.1.108	0.356	lactase.

[back to server]