StarFunc result for job id P09874

User Input

>input (1014 residues)
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R3T8	0.915	0.915	0.000	1014	1.000	1.000	A0A024R3T8.pdb.gz
2	AFDB:P26446	0.848	0.851	0.000	1011	0.787	0.789	P26446.pdb.gz	PARP1_CHICK Poly [ADP-ribose] polymerase 1 OS=Gallus gallus OX=9031 GN=PARP1 PE=1 SV=2
3	AFDB:P35875	0.769	0.784	0.000	994	0.411	0.420	P35875.pdb.gz	PARP_DROME Poly [ADP-ribose] polymerase OS=Drosophila melanogaster OX=7227 GN=Parp PE=1 SV=1
4	AFDB:Q5RHR0	0.859	0.860	0.000	1013	0.707	0.708	Q5RHR0.pdb.gz	PARP1_DANRE Poly [ADP-ribose] polymerase 1 OS=Danio rerio OX=7955 GN=parp1 PE=2 SV=1
5	AFDB:Q9ZP54	0.675	0.696	8.482E-96	983	0.380	0.392	Q9ZP54.pdb.gz	PARP1_ARATH Poly [ADP-ribose] polymerase 1 OS=Arabidopsis thaliana OX=3702 GN=PARP1 PE=1 SV=2
6	AFDB:Q9N4H4	0.652	0.697	4.542E-79	945	0.320	0.343	Q9N4H4.pdb.gz	PARP1_CAEEL Poly [ADP-ribose] polymerase 1 OS=Caenorhabditis elegans OX=6239 GN=parp-1 PE=1 SV=1
7	AFDB:Q54XI2	0.533	0.574	5.197E-76	938	0.285	0.308	Q54XI2.pdb.gz	Q54XI2_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt1A PE=3 SV=1
8	AFDB:Q57ZY1	0.467	0.818	1.480E-60	573	0.231	0.408	Q57ZY1.pdb.gz	Q57ZY1_TRYB2 Poly [ADP-ribose] polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.30 PE=4 SV=1
9	AFDB:Q8I7C6	0.467	0.666	1.832E-60	700	0.235	0.340	Q8I7C6.pdb.gz	Q8I7C6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt2 PE=2 SV=1
10	AFDB:Q54X55	0.541	0.676	1.816E-59	804	0.227	0.286	Q54X55.pdb.gz	Q54X55_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt1B PE=4 SV=1
11	PDB:6x0lP	0.437	0.908	3.637E-50	474	0.202	0.432	6x0lP.pdb.gz	Bridging of DNA breaks activates PARP2-HPF1 to modify chromatin.
12	PDB:1ikpA	0.101	0.150	8.781E-3	599	0.052	0.088	1ikpA.pdb.gz
13	PDB:7yzpC	0.052	0.095	1.955E-2	448	0.047	0.107	7yzpC.pdb.gz	Structural mechanism of endonucleolytic processing of blocked DNA ends and hairpins by Mre11-Rad50.
14	PDB:6wgeB	0.040	0.073	1.652E-1	490	0.019	0.039	6wgeB.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
15	PDB:6cfwJ	0.055	0.298	2.531E-1	143	0.014	0.098	6cfwJ.pdb.gz	Structure of an Ancient Respiratory System.
16	PDB:6s85D	0.049	0.096	4.551E-1	375	0.034	0.091	6s85D.pdb.gz	Mechanism of DNA End Sensing and Processing by the Mre11-Rad50 Complex.
17	PDB:1twaA	0.040	0.032	5.943E-1	1352	0.042	0.032	1twaA.pdb.gz	Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
18	PDB:8dr5A	0.068	0.105	5.943E-1	646	0.016	0.025	8dr5A.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
19	PDB:3obzA	0.044	0.102	7.760E-1	290	0.029	0.100	3obzA.pdb.gz	Crystal Structure of Human PHYHD1, a Non-Heme Fe(II) and 2-Oxoglutarate Dependent Oxygenase Related to Phytanoyl-CoA Hydroxylase
20	PDB:8d3xA	0.036	0.037	8.633E-1	989	0.045	0.047	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09874	0.0	2088	1014	1.000	1.000	PARP1_HUMAN Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4
2	P11103	0.0	1931	1013	0.920	0.921	PARP1_MOUSE Poly [ADP-ribose] polymerase 1 OS=Mus musculus OX=10090 GN=Parp1 PE=1 SV=3
3	P26446	0.0	1609	1011	0.789	0.791	PARP1_CHICK Poly [ADP-ribose] polymerase 1 OS=Gallus gallus OX=9031 GN=PARP1 PE=1 SV=2
4	P27008	0.0	1867	1014	0.917	0.917	PARP1_RAT Poly [ADP-ribose] polymerase 1 OS=Rattus norvegicus OX=10116 GN=Parp1 PE=1 SV=4
5	P35875	0.0	775	994	0.419	0.428	PARP_DROME Poly [ADP-ribose] polymerase OS=Drosophila melanogaster OX=7227 GN=Parp PE=1 SV=1
6	Q5RHR0	0.0	1480	1013	0.711	0.712	PARP1_DANRE Poly [ADP-ribose] polymerase 1 OS=Danio rerio OX=7955 GN=parp1 PE=2 SV=1
7	Q9ZP54	0.0	652	983	0.393	0.406	PARP1_ARATH Poly [ADP-ribose] polymerase 1 OS=Arabidopsis thaliana OX=3702 GN=PARP1 PE=1 SV=2
8	Q57ZY1	4.91e-131	410	573	0.226	0.400	Q57ZY1_TRYB2 Poly [ADP-ribose] polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.30 PE=4 SV=1
9	Q9N4H4	3.02e-128	414	945	0.215	0.231	PARP1_CAEEL Poly [ADP-ribose] polymerase 1 OS=Caenorhabditis elegans OX=6239 GN=parp-1 PE=1 SV=1
10	O88554	2.54e-122	387	559	0.207	0.376	PARP2_MOUSE Poly [ADP-ribose] polymerase 2 OS=Mus musculus OX=10090 GN=Parp2 PE=1 SV=3
11	G3V749	1.43e-121	385	558	0.210	0.382	G3V749_RAT Poly (ADP-ribose) polymerase 2 OS=Rattus norvegicus OX=10116 GN=Parp2 PE=3 SV=1
12	Q9UGN5	6.22e-121	384	583	0.212	0.369	PARP2_HUMAN Poly [ADP-ribose] polymerase 2 OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=2
13	Q54XI2	2.14e-119	390	938	0.304	0.328	Q54XI2_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt1A PE=3 SV=1
14	Q11207	1.12e-118	380	637	0.210	0.334	PARP2_ARATH Poly [ADP-ribose] polymerase 2 OS=Arabidopsis thaliana OX=3702 GN=PARP2 PE=2 SV=1
15	Q8I7C6	5.59e-110	358	700	0.208	0.301	Q8I7C6_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt2 PE=2 SV=1
16	G3V167	9.57e-105	339	531	0.187	0.358	G3V167_HUMAN Poly [ADP-ribose] polymerase OS=Homo sapiens OX=9606 GN=PARP2 PE=1 SV=1
17	Q54E42	3.16e-83	298	2536	0.184	0.074	Q54E42_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt3 PE=4 SV=1
18	Q7ZVB0	1.28e-77	266	531	0.176	0.335	Q7ZVB0_DANRE Poly [ADP-ribose] polymerase OS=Danio rerio OX=7955 GN=fj17c06 PE=1 SV=2
19	Q54X55	1.38e-72	259	804	0.167	0.210	Q54X55_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=adprt1B PE=4 SV=1
20	Q9Y6F1	8.31e-64	228	533	0.169	0.321	PARP3_HUMAN Protein mono-ADP-ribosyltransferase PARP3 OS=Homo sapiens OX=9606 GN=PARP3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	8.7e-07	40.5	BRCA1 C Terminus (BRCT) domain
2	PF16589 BRCT_2	15	17.4	BRCT domain, a BRCA1 C-terminus domain
3	PF18209 ESF1	6.7e+02	11.9	Embryo surrounding factor 1
4	PF08063 PADR1	4.9e-18	76.0	PADR1 (NUC008) domain
5	PF00644 PARP	2.7e-70	247.4	Poly(ADP-ribose) polymerase catalytic domain
6	PF02877 PARP_reg	2.4e-47	171.9	Poly(ADP-ribose) polymerase, regulatory domain
7	PF05406 WGR	9.4e-19	78.6	WGR domain
8	PF00645 zf-PARP	7e-36	134.1	Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262887	0.999	DNA repair protein XRCC1
2	9606.ENSP00000311032	0.998	Caspase-3
3	9606.ENSP00000384408	0.998	Poly(ADP-ribose) glycohydrolase
4	9606.ENSP00000265421	0.996	DNA polymerase beta
5	9606.ENSP00000298139	0.992	Werner syndrome ATP-dependent helicase
6	9606.ENSP00000375978	0.992	X-ray repair cross-complementing protein 5
7	9606.ENSP00000352257	0.991	X-ray repair cross-complementing protein 6
8	9606.ENSP00000358327	0.991	Caspase-7
9	9606.ENSP00000450607	0.991	Protein timeless homolog
10	9606.ENSP00000313420	0.990	DNA-dependent protein kinase catalytic subunit
11	9606.ENSP00000256996	0.989	DNA damage-binding protein 2
12	9606.ENSP00000348056	0.989	SUMO-conjugating enzyme UBC9
13	9606.ENSP00000358262	0.987	Chromodomain-helicase-DNA-binding protein 1-like
14	9606.ENSP00000262971	0.985	E3 SUMO-protein ligase PIAS4
15	9606.ENSP00000354522	0.985	DNA topoisomerase 1
16	9606.ENSP00000269305	0.983	Cellular tumor antigen p53
17	9606.ENSP00000364270	0.973	DNA repair protein complementing XP-A cells
18	9606.ENSP00000423563	0.972	Core histone macro-H2A.1
19	9606.ENSP00000278616	0.969	Serine-protein kinase ATM
20	9606.ENSP00000434024	0.969	Histone H2AX

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003950	1.000	NAD+ ADP-ribosyltransferase activity
GO:1990404	1.000	NAD+-protein ADP-ribosyltransferase activity
GO:0005515	0.992	protein binding
GO:1901363	0.882	heterocyclic compound binding
GO:0097159	0.881	organic cyclic compound binding
GO:0003676	0.631	nucleic acid binding
GO:0019899	0.597	enzyme binding
GO:0003677	0.534	DNA binding
GO:0003723	0.405	RNA binding
GO:0003682	0.401	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0009987	0.985	cellular process
GO:0050896	0.978	response to stimulus
GO:0050794	0.978	regulation of cellular process
GO:0051716	0.969	cellular response to stimulus
GO:0019222	0.965	regulation of metabolic process
GO:0080090	0.962	regulation of primary metabolic process
GO:0044237	0.946	cellular metabolic process
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0051171	0.937	regulation of nitrogen compound metabolic process
GO:0048518	0.934	positive regulation of biological process
GO:0006950	0.931	response to stress
GO:1901564	0.925	organonitrogen compound metabolic process
GO:0031323	0.924	regulation of cellular metabolic process
GO:0019538	0.893	protein metabolic process
GO:0033554	0.876	cellular response to stress
GO:0036211	0.857	protein modification process
GO:0019219	0.850	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.842	positive regulation of cellular process
GO:0043687	0.837	post-translational protein modification
GO:0006974	0.820	cellular response to DNA damage stimulus
GO:0010604	0.797	positive regulation of macromolecule metabolic process
GO:0051173	0.745	positive regulation of nitrogen compound metabolic process
GO:0006281	0.723	DNA repair
GO:0048583	0.702	regulation of response to stimulus
GO:0031325	0.702	positive regulation of cellular metabolic process
GO:0051052	0.615	regulation of DNA metabolic process
GO:0045935	0.615	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.593	negative regulation of biological process
GO:0010468	0.591	regulation of gene expression
GO:0080134	0.588	regulation of response to stress
GO:0080135	0.584	regulation of cellular response to stress
GO:0048584	0.574	positive regulation of response to stimulus
GO:0042221	0.516	response to chemical
GO:0048523	0.484	negative regulation of cellular process
GO:0071840	0.397	cellular component organization or biogenesis
GO:0016043	0.390	cellular component organization
GO:1901700	0.381	response to oxygen-containing compound
GO:0031326	0.346	regulation of cellular biosynthetic process
GO:0051252	0.337	regulation of RNA metabolic process
GO:0010556	0.331	regulation of macromolecule biosynthetic process
GO:0010033	0.330	response to organic substance
GO:2001141	0.305	regulation of RNA biosynthetic process
GO:0009892	0.304	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005737	0.994	cytoplasm
GO:0032991	0.990	protein-containing complex
GO:0005730	0.982	nucleolus
GO:0005829	0.862	cytosol
GO:0016604	0.761	nuclear body
GO:0005694	0.380	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.30	1.000	NAD(+) ADP-ribosyltransferase.

[back to server]