StarFunc result for job id P09884

User Input

>input (1462 residues)
MAPVHGDDSLSDSGSFVSSRARREKKSKKGRQEALERLKKAKAGEKYKYEVEDFTGVYEE
VDEEQYSKLVQARQDDDWIVDDDGIGYVEDGREIFDDDLEDDALDADEKGKDGKARNKDK
RNVKKLAVTKPNNIKSMFIACAGKKTADKAVDLSKDGLLGDILQDLNTETPQITPPPVMI
LKKKRSIGASPNPFSVHTATAVPSGKIASPVSRKEPPLTPVPLKRAEFAGDDVQVESTEE
EQESGAMEFEDGDFDEPMEVEEVDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSF
LPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVF
LFGKVWIESAETHVSCCVMVKNIERTLYFLPREMKIDLNTGKETGTPISMKDVYEEFDEK
IATKYKIMKFKSKPVEKNYAFEIPDVPEKSEYLEVKYSAEMPQLPQDLKGETFSHVFGTN
TSSLELFLMNRKIKGPCWLEVKSPQLLNQPVSWCKVEAMALKPDLVNVIKDVSPPPLVVM
AFSMKTMQNAKNHQNEIIAMAALVHHSFALDKAAPKPPFQSHFCVVSKPKDCIFPYAFKE
VIEKKNVKVEVAATERTLLGFFLAKVHKIDPDIIVGHNIYGFELEVLLQRINVCKAPHWS
KIGRLKRSNMPKLGGRSGFGERNATCGRMICDVEISAKELIRCKSYHLSELVQQILKTER
VVIPMENIQNMYSESSQLLYLLEHTWKDAKFILQIMCELNVLPLALQITNIAGNIMSRTL
MGGRSERNEFLLLHAFYENNYIVPDKQIFRKPQQKLGDEDEEIDGDTNKYKKGRKKAAYA
GGLVLDPKVGFYDKFILLLDFNSLYPSIIQEFNICFTTVQRVASEAQKVTEDGEQEQIPE
LPDPSLEMGILPREIRKLVERRKQVKQLMKQQDLNPDLILQYDIRQKALKLTANSMYGCL
GFSYSRFYAKPLAALVTYKGREILMHTKEMVQKMNLEVIYGDTDSIMINTNSTNLEEVFK
LGNKVKSEVNKLYKLLEIDIDGVFKSLLLLKKKKYAALVVEPTSDGNYVTKQELKGLDIV
RRDWCDLAKDTGNFVIGQILSDQSRDTIVENIQKRLIEIGENVLNGSVPVSQFEINKALT
KDPQDYPDKKSLPHVHVALWINSQGGRKVKAGDTVSYVICQDGSNLTASQRAYAPEQLQK
QDNLTIDTQYYLAQQIHPVVARICEPIDGIDAVLIATWLGLDPTQFRVHHYHKDEENDAL
LGGPAQLTDEEKYRDCERFKCPCPTCGTENIYDNVFDGSGTDMEPSLYRCSNIDCKASPL
TFTVQLSNKLIMDIRRFIKKYYDGWLICEEPTCRNRTRHLPLQFSRTGPLCPACMKATLQ
PEYSDKSLYTQLCFYRYIFDAECALEKLTTDHEKDKLKKQFFTPKVLQDYRKLKNTAEQF
LSRSGYSEVNLSKLFAGCAVKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:8d0kF	0.476	0.753	0.000	915	0.626	1.000	8d0kF.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
2	AFDB:P09884	1.000	1.000	0.000	1462	1.000	1.000	P09884.pdb.gz	DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2
3	AFDB:P28040	0.611	0.635	0.000	1405	0.340	0.354	P28040.pdb.gz	DPOLA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol1 PE=1 SV=1
4	AFDB:Q9DE46	0.785	0.788	0.000	1458	0.716	0.718	Q9DE46.pdb.gz	DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis OX=8355 GN=pola1 PE=1 SV=1
5	PDB:7kc0A	0.491	0.701	1.215E-44	1004	0.155	0.226	7kc0A.pdb.gz	Structure of eukaryotic DNA polymerase delta bound to the PCNA clamp while encircling DNA.
6	PDB:6s1mA	0.486	0.688	1.198E-42	1010	0.160	0.232	6s1mA.pdb.gz	Structure of the processive human Pol delta holoenzyme.
7	PDB:7lufB	0.488	0.664	5.168E-39	1054	0.120	0.167	7lufB.pdb.gz	Structural understanding of non-nucleoside inhibition in an elongating herpesvirus polymerase.
8	PDB:3k57A	0.445	0.796	1.617E-37	782	0.123	0.230	3k57A.pdb.gz	Structural insight into translesion synthesis by DNA Pol II
9	PDB:3k5nA	0.421	0.763	2.681E-34	759	0.117	0.225	3k5nA.pdb.gz	Structural insight into translesion synthesis by DNA Pol II.
10	PDB:6v93A	0.487	0.560	7.625E-33	1259	0.127	0.147	6v93A.pdb.gz	Structure and mechanism of B-family DNA polymerase zeta specialized for translesion DNA synthesis.
11	PDB:6wjvA	0.425	0.327	1.891E-25	1951	0.112	0.084	6wjvA.pdb.gz
12	PDB:4i9qB	0.387	0.616	8.616E-23	873	0.105	0.175	4i9qB.pdb.gz	A Remote Palm Domain Residue of RB69 DNA Polymerase Is Critical for Enzyme Activity and Influences the Conformation of the Active Site.
13	PDB:2oyqA	0.354	0.585	3.795E-22	848	0.090	0.156	2oyqA.pdb.gz	Caught bending the a-rule: crystal structures of translesion DNA synthesis with a non-natural nucleotide.
14	AFDB:Q700C2	0.045	0.053	4.427E-2	988	0.061	0.090	Q700C2.pdb.gz	SPL16_ARATH Squamosa promoter-binding-like protein 16 OS=Arabidopsis thaliana OX=3702 GN=SPL16 PE=2 SV=2
15	AFDB:A5X572	0.095	0.113	7.142E-2	1146	0.083	0.106	A5X572.pdb.gz	A5X572_DANRE DNA polymerase nu OS=Danio rerio OX=7955 GN=POLN PE=2 SV=1
16	AFDB:Q8WR08	0.051	0.061	9.982E-2	1179	0.054	0.067	Q8WR08.pdb.gz	Q8WR08_DROME Dystroglycan 1 OS=Drosophila melanogaster OX=7227 GN=Dg PE=1 SV=1
17	AFDB:A0A0C4DHF6	0.048	0.054	1.395E-1	1262	0.053	0.062	A0A0C4DHF6.pdb.gz	A0A0C4DHF6_DROME Dystroglycan 1 OS=Drosophila melanogaster OX=7227 GN=Dg PE=1 SV=1
18	AFDB:A0A096MJ01	0.031	0.053	2.146E-1	726	0.042	0.085	A0A096MJ01.pdb.gz	A0A096MJ01_RAT LIM domain binding 3 OS=Rattus norvegicus OX=10116 GN=Ldb3 PE=1 SV=2
19	AFDB:D9PTN5	0.029	0.039	3.461E-1	1009	0.037	0.054	D9PTN5.pdb.gz	MYRF2_CAEEL Myelin regulatory factor homolog 2 OS=Caenorhabditis elegans OX=6239 GN=myrf-2 PE=1 SV=1
20	AFDB:Q9WU62	0.024	0.035	8.588E-1	880	0.040	0.067	Q9WU62.pdb.gz	INCE_MOUSE Inner centromere protein OS=Mus musculus OX=10090 GN=Incenp PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NMQ1	0.0	3024	1468	0.999	0.995	A6NMQ1_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=1
2	O48653	0.0	771	1534	0.376	0.358	DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0868300 PE=2 SV=2
3	O89042	0.0	2628	1451	0.890	0.897	DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus OX=10116 GN=Pola1 PE=1 SV=1
4	P09884	0.0	3033	1462	1.000	1.000	DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2
5	P13382	0.0	645	1468	0.274	0.272	DPOLA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=POL1 PE=1 SV=2
6	P26019	0.0	981	1488	0.408	0.401	DPOLA_DROME DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster OX=7227 GN=PolA1 PE=1 SV=2
7	P28040	0.0	785	1405	0.341	0.355	DPOLA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol1 PE=1 SV=1
8	P33609	0.0	2598	1465	0.881	0.879	DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus OX=10090 GN=Pola1 PE=1 SV=2
9	Q59J86	0.0	2154	1462	0.737	0.737	Q59J86_CHICK DNA polymerase (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q9DE46	0.0	2100	1458	0.723	0.725	DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis OX=8355 GN=pola1 PE=1 SV=1
11	Q9FHA3	0.0	790	1524	0.369	0.354	DPOLA_ARATH DNA polymerase alpha catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=POLA PE=3 SV=2
12	Q57UW4	8.04e-169	545	1340	0.230	0.251	Q57UW4_TRYB2 DNA polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.580 PE=3 SV=1
13	P28339	3.73e-56	216	1106	0.146	0.193	DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus OX=9913 GN=POLD1 PE=1 SV=1
14	P52431	1.37e-54	211	1105	0.139	0.184	DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus OX=10090 GN=Pold1 PE=1 SV=2
15	O54747	6.73e-54	209	1103	0.137	0.182	DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus OX=10116 GN=Pold1 PE=2 SV=1
16	P30316	7.52e-54	208	1086	0.142	0.191	DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pol3 PE=1 SV=2
17	P28340	8.00e-54	208	1107	0.146	0.192	DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=2
18	M0R2B7	1.83e-51	201	1133	0.148	0.191	M0R2B7_HUMAN DNA polymerase OS=Homo sapiens OX=9606 GN=POLD1 PE=1 SV=1
19	Q585S7	2.88e-51	200	1026	0.122	0.173	Q585S7_TRYB2 DNA polymerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=27H14.40 PE=3 SV=1
20	Q2KNE0	2.52e-50	197	1105	0.122	0.162	Q2KNE0_DANRE DNA polymerase OS=Danio rerio OX=7955 GN=zgc:152688 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12254 DNA_pol_alpha_N	1.3e-13	62.1	DNA polymerase alpha subunit p180 N terminal
2	PF00136 DNA_pol_B	1.8e-132	454.0	DNA polymerase family B
3	PF03175 DNA_pol_B_2	6.4	17.2	DNA polymerase type B, organellar and viral
4	PF03104 DNA_pol_B_exo1	3.4e-59	212.3	DNA polymerase family B, exonuclease domain
5	PF08490 DUF1744	7.4	16.7	Domain of unknown function (DUF1744)
6	PF13234 rRNA_proc-arch	1.9e+02	13.3	rRNA-processing arch domain
7	PF08996 zf-DNA_Pol	2.5e-51	185.5	DNA Polymerase alpha zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368349

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265465	0.999	DNA polymerase alpha subunit B
2	9606.ENSP00000322570	0.999	DNA polymerase epsilon catalytic subunit A
3	9606.ENSP00000350491	0.999	DNA primase small subunit
4	9606.ENSP00000405726	0.999	Cell division control protein 45 homolog
5	9606.ENSP00000484105	0.999	DNA primase large subunit
6	9606.ENSP00000216367	0.998	DNA polymerase epsilon subunit 2
7	9606.ENSP00000262105	0.998	DNA replication licensing factor MCM4
8	9606.ENSP00000265056	0.998	DNA replication licensing factor MCM2
9	9606.ENSP00000353793	0.998	WD repeat and HMG-box DNA-binding protein 1
10	9606.ENSP00000480987	0.998	DNA replication licensing factor MCM3
11	9606.ENSP00000209728	0.997	Cell division control protein 6 homolog
12	9606.ENSP00000263681	0.997	DNA polymerase delta subunit 3
13	9606.ENSP00000480186	0.997	DNA polymerase delta subunit 2
14	9606.ENSP00000264156	0.996	DNA replication licensing factor MCM6
15	9606.ENSP00000216122	0.995	DNA replication licensing factor MCM5
16	9606.ENSP00000307288	0.995	DNA replication licensing factor MCM7
17	9606.ENSP00000418268	0.995	Protein MCM10 homolog
18	9606.ENSP00000368458	0.993	Proliferating cell nuclear antigen
19	9606.ENSP00000262315	0.991	Chromosome transmission fidelity protein 18 homolog
20	9606.ENSP00000360623	0.991	Origin recognition complex subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003887	1.000	DNA-directed DNA polymerase activity
GO:0003676	0.987	nucleic acid binding
GO:0003677	0.983	DNA binding
GO:0019899	0.936	enzyme binding
GO:0003682	0.916	chromatin binding
GO:0000166	0.916	nucleotide binding
GO:0043167	0.702	ion binding
GO:0046872	0.647	metal ion binding
GO:0019900	0.635	kinase binding
GO:0019901	0.626	protein kinase binding
GO:0008270	0.615	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006259	0.997	DNA metabolic process
GO:0006260	0.988	DNA replication
GO:0034654	0.940	nucleobase-containing compound biosynthetic process
GO:0071897	0.877	DNA biosynthetic process
GO:0006974	0.859	cellular response to DNA damage stimulus
GO:0050789	0.820	regulation of biological process
GO:0006281	0.766	DNA repair
GO:0060255	0.643	regulation of macromolecule metabolic process
GO:0006261	0.595	DNA-templated DNA replication
GO:0050794	0.487	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.999	catalytic complex
GO:0140513	0.999	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0005829	0.996	cytosol
GO:0000228	0.995	nuclear chromosome
GO:0005658	0.987	alpha DNA polymerase:primase complex
GO:0000785	0.374	chromatin
GO:0005730	0.355	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.7	1.000	DNA-directed DNA polymerase.

[back to server]