StarFunc result for job id P09912

User Input

>input (130 residues)
MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALG
FTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATH
KYLDSEEDEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09912	1.000	1.000	4.231E-19	130	1.000	1.000	P09912.pdb.gz	IFI6_HUMAN Interferon alpha-inducible protein 6 OS=Homo sapiens OX=9606 GN=IFI6 PE=1 SV=2
2	AFDB:P40305	0.380	0.394	4.967E-3	122	0.323	0.344	P40305.pdb.gz	IFI27_HUMAN Interferon alpha-inducible protein 27, mitochondrial OS=Homo sapiens OX=9606 GN=IFI27 PE=1 SV=4
3	AFDB:Q70LN3	0.208	0.130	5.024E-1	260	0.362	0.181	Q70LN3.pdb.gz	Q70LN3_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
4	AFDB:O14524	0.242	0.101	1.072	444	0.146	0.043	O14524.pdb.gz	NEMP1_HUMAN Nuclear envelope integral membrane protein 1 OS=Homo sapiens OX=9606 GN=NEMP1 PE=1 SV=2
5	AFDB:Q9VKK5	0.145	0.153	2.626	122	0.223	0.238	Q9VKK5.pdb.gz	Q9VKK5_DROME Allatostatin C, isoform A OS=Drosophila melanogaster OX=7227 GN=AstC PE=1 SV=1
6	AFDB:Q0WUC5	0.169	0.045	4.253	566	0.185	0.042	Q0WUC5.pdb.gz	ALB33_ARATH ALBINO3-like protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALB3L3 PE=1 SV=1
7	AFDB:Q3V5L5	0.202	0.058	4.557	792	0.208	0.034	Q3V5L5.pdb.gz	MGT5B_HUMAN Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B OS=Homo sapiens OX=9606 GN=MGAT5B PE=1 SV=2
8	AFDB:P40442	0.221	0.039	5.603	995	0.138	0.018	P40442.pdb.gz	CSS1_YEAST Secreted protein CSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSS1 PE=2 SV=1
9	AFDB:Q86W92	0.197	0.045	5.603	1011	0.200	0.026	Q86W92.pdb.gz	LIPB1_HUMAN Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1 PE=1 SV=2
10	AFDB:Q2F960	0.221	0.181	6.431	165	0.123	0.097	Q2F960.pdb.gz	Q2F960_ORYSI Uncharacterized protein orf165 OS=Oryza sativa subsp. indica OX=39946 GN=orf165 PE=4 SV=1
11	PDB:5gm6c	0.203	0.075	7.644	415	0.146	0.046	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:7mqaLY	0.148	0.176	7.644	95	0.115	0.158	7mqaLY.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7qooH	0.246	0.176	8.773	210	0.146	0.090	7qooH.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09912	2.63e-88	254	130	1.000	1.000	IFI6_HUMAN Interferon alpha-inducible protein 6 OS=Homo sapiens OX=9606 GN=IFI6 PE=1 SV=2
2	G3V761	7.65e-18	77.0	182	0.385	0.275	G3V761_RAT Interferon, alpha-inducible protein 27 OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=3 SV=1
3	Q6P9X5	1.06e-17	76.6	182	0.385	0.275	Q6P9X5_RAT Interferon, alpha-inducible protein 27-like OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=2 SV=1
4	D3ZIG6	1.28e-16	73.9	179	0.369	0.268	D3ZIG6_RAT Interferon, alpha-inducible protein 27 OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=3 SV=3
5	A0A8I5ZTN9	2.08e-16	73.9	209	0.385	0.239	A0A8I5ZTN9_RAT Interferon, alpha-inducible protein 27 OS=Rattus norvegicus OX=10116 GN=Ifi27 PE=3 SV=1
6	Q70LN3	2.86e-16	74.3	260	0.362	0.181	Q70LN3_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
7	Q8C6G0	2.92e-16	74.3	260	0.362	0.181	Q8C6G0_MOUSE Interferon, alpha-inducible protein 27 OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=2
8	E9Q1C5	2.71e-15	71.6	250	0.338	0.176	E9Q1C5_MOUSE Interferon, alpha-inducible protein 27 OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
9	Q9D1E1	2.75e-15	70.9	215	0.331	0.200	Q9D1E1_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
10	Q70LN2	3.06e-15	71.6	250	0.338	0.176	Q70LN2_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
11	Q70LM9	5.11e-15	69.3	165	0.338	0.267	Q70LM9_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
12	Q70LN0	1.02e-14	69.3	205	0.346	0.220	Q70LN0_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=1 SV=1
13	P40305	3.05e-14	66.2	122	0.308	0.328	IFI27_HUMAN Interferon alpha-inducible protein 27, mitochondrial OS=Homo sapiens OX=9606 GN=IFI27 PE=1 SV=4
14	Q8R412	3.54e-14	65.1	90	0.308	0.444	IF27A_MOUSE Interferon alpha-inducible protein 27-like protein 2A OS=Mus musculus OX=10090 GN=Ifi27l2a PE=2 SV=1
15	Q3UK07	7.72e-14	67.4	215	0.323	0.195	Q3UK07_MOUSE ISG12a protein OS=Mus musculus OX=10090 GN=Ifi27 PE=2 SV=1
16	Q96BM0	6.22e-13	62.4	104	0.308	0.385	I27L1_HUMAN Interferon alpha-inducible protein 27-like protein 1 OS=Homo sapiens OX=9606 GN=IFI27L1 PE=1 SV=1
17	Q9H2X8	8.11e-08	49.7	130	0.292	0.292	I27L2_HUMAN Interferon alpha-inducible protein 27-like protein 2 OS=Homo sapiens OX=9606 GN=IFI27L2 PE=2 SV=1
18	Q8VC49	0.028	35.4	283	0.362	0.166	IF27B_MOUSE Interferon alpha-inducible protein 27-like protein 2B OS=Mus musculus OX=10090 GN=Ifi27l2b PE=1 SV=1
19	Q69Y51	0.12	33.9	401	0.208	0.067	Q69Y51_ORYSJ BHLH transcription factor PTF1 OS=Oryza sativa subsp. japonica OX=39947 GN=P0698A06.26-2 PE=3 SV=1
20	B0S7B8	1.1	31.2	1228	0.246	0.026	B0S7B8_DANRE Anion exchange protein OS=Danio rerio OX=7955 GN=slc4a2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06140 Ifi-6-16	1.7e-15	68.0	Interferon-induced 6-16 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000001916

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000002343	0.956	ISG15 ubiquitin-like modifier
2	9601.ENSPPYP00000005679	0.943	2'-5'-oligoadenylate synthase 1
3	9601.ENSPPYP00000012765	0.932	Interferon-induced dynamin-like GTPase with antiviral activity
4	9601.ENSPPYP00000002857	0.911	Pongo abelii interferon-induced protein with tetratricopeptide repeats 1 (IFIT1), mRNA
5	9601.ENSPPYP00000002854	0.902	Pongo abelii interferon-induced protein with tetratricopeptide repeats 3 (IFIT3), mRNA
6	9601.ENSPPYP00000005680	0.888	2'-5'-oligoadenylate synthetase 3, 100kDa
7	9601.ENSPPYP00000005747	0.888	2'-5'-oligoadenylate synthetase-like
8	9601.ENSPPYP00000014148	0.873	Interferon-inducible iron-sulfur (4FE-4S) cluster-binding antiviral protein which plays a major role in the cell antiviral state induced by type I and type II interferon. Can inhibit a wide range of viruses, including west Nile virus (WNV), dengue virus, sindbis virus, influenza A virus, sendai virus and vesicular stomatitis virus (VSV). Displays antiviral activity against influenza A virus by inhibiting the budding of the virus from the plasma membrane by disturbing the lipid rafts. This is accomplished, at least in part, through binding and inhibition of the enzyme farnesyl diphospha [...]
9	9601.ENSPPYP00000001408	0.871	Interferon-induced protein 44
10	9601.ENSPPYP00000006933	0.864	Interferon, alpha-inducible protein 27
11	9601.ENSPPYP00000009408	0.858	Interferon-induced protein 35
12	9601.ENSPPYP00000001409	0.853	Interferon-induced protein 44-like
13	9601.ENSPPYP00000006466	0.843	Interferon regulatory factor 9
14	9601.ENSPPYP00000008872	0.816	XIAP associated factor 1
15	9601.ENSPPYP00000003337	0.810	Interferon regulatory factor 7
16	9601.ENSPPYP00000012763	0.798	MX dynamin-like GTPase 2
17	9601.ENSPPYP00000002853	0.797	Pongo abelii interferon-induced protein with tetratricopeptide repeats 2 (IFIT2), mRNA
18	9601.ENSPPYP00000014555	0.792	Pongo abelii signal transducer and activator of transcription 1, 91kDa (STAT1), mRNA
19	9601.ENSPPYP00000002858	0.779	Pongo abelii interferon-induced protein with tetratricopeptide repeats 5 (IFIT5), mRNA
20	9601.ENSPPYP00000007665	0.760	Interferon stimulated exonuclease gene 20kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0065007	0.985	biological regulation
GO:0009987	0.984	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0044419	0.975	biological process involved in interspecies interaction between organisms
GO:0051707	0.970	response to other organism
GO:0009615	0.953	response to virus
GO:0006950	0.945	response to stress
GO:0098542	0.930	defense response to other organism
GO:0060255	0.918	regulation of macromolecule metabolic process
GO:0051607	0.910	defense response to virus
GO:0048519	0.906	negative regulation of biological process
GO:0051716	0.893	cellular response to stimulus
GO:0002376	0.884	immune system process
GO:0006955	0.869	immune response
GO:0007165	0.868	signal transduction
GO:0051171	0.851	regulation of nitrogen compound metabolic process
GO:0080090	0.849	regulation of primary metabolic process
GO:0048583	0.841	regulation of response to stimulus
GO:0048523	0.818	negative regulation of cellular process
GO:0045087	0.808	innate immune response
GO:0012501	0.761	programmed cell death
GO:0048585	0.655	negative regulation of response to stimulus
GO:0006915	0.599	apoptotic process
GO:0010605	0.582	negative regulation of macromolecule metabolic process
GO:0009966	0.574	regulation of signal transduction
GO:0008152	0.519	metabolic process
GO:0048518	0.376	positive regulation of biological process
GO:0065009	0.359	regulation of molecular function
GO:0051246	0.317	regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	0.999	mitochondrial membrane
GO:0005886	0.998	plasma membrane
GO:0019866	0.994	organelle inner membrane
GO:0005743	0.952	mitochondrial inner membrane
GO:0005634	0.859	nucleus
GO:0012505	0.641	endomembrane system
GO:0005829	0.500	cytosol
GO:0005783	0.350	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]