StarFunc result for job id P09914

User Input

>input (478 residues)
MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAY
VKHLKGQNEEALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDK
VENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAG
YAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYI
EEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQETPTSVLLHHQIGLCYKAQMI
QIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMYIEAGNHRKAE
ENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09914	1.000	1.000	2.676E-58	478	1.000	1.000	P09914.pdb.gz	IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 OS=Homo sapiens OX=9606 GN=IFIT1 PE=1 SV=2
2	PDB:5udkA	0.958	0.993	8.174E-52	461	0.958	0.993	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
3	PDB:5w5iC	0.895	0.981	4.290E-46	436	0.904	0.991	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
4	AFDB:Q5T764	0.928	0.935	2.373E-40	474	0.667	0.673	Q5T764.pdb.gz	IFT1B_HUMAN Interferon-induced protein with tetratricopeptide repeats 1B OS=Homo sapiens OX=9606 GN=IFIT1B PE=1 SV=1
5	AFDB:Q64282	0.892	0.920	1.602E-35	463	0.515	0.531	Q64282.pdb.gz	IFIT1_MOUSE Interferon-induced protein with tetratricopeptide repeats 1 OS=Mus musculus OX=10090 GN=Ifit1 PE=1 SV=2
6	PDB:4horA	0.884	0.877	8.285E-35	482	0.554	0.550	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
7	AFDB:Q13325	0.892	0.885	9.828E-35	482	0.552	0.548	Q13325.pdb.gz	IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5 PE=1 SV=1
8	AFDB:Q8IZ03	0.807	0.798	3.507E-27	484	0.444	0.438	Q8IZ03.pdb.gz	Q8IZ03_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=2
9	AFDB:Q64112	0.753	0.761	1.067E-24	472	0.377	0.381	Q64112.pdb.gz	IFIT2_MOUSE Interferon-induced protein with tetratricopeptide repeats 2 OS=Mus musculus OX=10090 GN=Ifit2 PE=1 SV=1
10	AFDB:E7FBH4	0.852	0.845	2.929E-23	482	0.335	0.332	E7FBH4.pdb.gz	E7FBH4_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT12B PE=2 SV=1
11	AFDB:O14879	0.716	0.700	7.850E-23	490	0.423	0.412	O14879.pdb.gz	IFIT3_HUMAN Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1
12	PDB:4g1tB	0.627	0.688	8.255E-22	429	0.427	0.476	4g1tB.pdb.gz
13	AFDB:Q64345	0.613	0.718	1.184E-18	403	0.343	0.407	Q64345.pdb.gz	IFIT3_MOUSE Interferon-induced protein with tetratricopeptide repeats 3 OS=Mus musculus OX=10090 GN=Ifit3 PE=1 SV=1
14	AFDB:A0A068FR04	0.635	0.692	6.163E-15	433	0.234	0.259	A0A068FR04.pdb.gz	A0A068FR04_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT17A PE=2 SV=1
15	PDB:7ntfA	0.432	0.253	1.673E-8	918	0.180	0.094	7ntfA.pdb.gz
16	PDB:7qe7J	0.409	0.387	1.740E-8	510	0.157	0.147	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:7qe7K	0.403	0.367	1.522E-7	531	0.140	0.126	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:7dkhI	0.445	0.259	1.782E-7	914	0.142	0.074	7dkhI.pdb.gz
19	PDB:5dseA	0.423	0.384	1.928E-7	537	0.174	0.155	5dseA.pdb.gz
20	PDB:6bq1B	0.441	0.310	2.750E-7	728	0.172	0.113	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09914	0.0	993	478	1.000	1.000	IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 OS=Homo sapiens OX=9606 GN=IFIT1 PE=1 SV=2
2	Q13325	0.0	539	482	0.556	0.552	IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5 PE=1 SV=1
3	Q5T764	0.0	662	474	0.667	0.673	IFT1B_HUMAN Interferon-induced protein with tetratricopeptide repeats 1B OS=Homo sapiens OX=9606 GN=IFIT1B PE=1 SV=1
4	Q64282	3.80e-173	496	463	0.521	0.538	IFIT1_MOUSE Interferon-induced protein with tetratricopeptide repeats 1 OS=Mus musculus OX=10090 GN=Ifit1 PE=1 SV=2
5	P09913	5.32e-128	382	472	0.452	0.458	IFIT2_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=1
6	Q8IZ03	2.21e-127	380	484	0.452	0.446	Q8IZ03_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=2
7	O14879	1.72e-120	363	490	0.437	0.427	IFIT3_HUMAN Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1
8	Q5T765	1.72e-120	363	490	0.437	0.427	Q5T765_HUMAN Interferon-induced protein with tetratricopeptide repeats 3, isoform CRA_a OS=Homo sapiens OX=9606 GN=IFIT3 PE=2 SV=1
9	Q64112	3.11e-112	341	472	0.383	0.388	IFIT2_MOUSE Interferon-induced protein with tetratricopeptide repeats 2 OS=Mus musculus OX=10090 GN=Ifit2 PE=1 SV=1
10	Q64345	3.52e-90	282	403	0.341	0.404	IFIT3_MOUSE Interferon-induced protein with tetratricopeptide repeats 3 OS=Mus musculus OX=10090 GN=Ifit3 PE=1 SV=1
11	E7FBH4	1.19e-85	273	482	0.337	0.334	E7FBH4_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT12B PE=2 SV=1
12	A0A068FR04	1.46e-38	147	433	0.247	0.273	A0A068FR04_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT17A PE=2 SV=1
13	Q7KJA9	2.78e-08	58.9	1059	0.117	0.053	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
14	Q9Y148	2.92e-08	58.9	1011	0.117	0.055	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
15	P56558	4.55e-07	55.1	1036	0.111	0.051	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
16	O15294	4.72e-07	55.1	1046	0.111	0.051	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
17	P81436	4.80e-07	55.1	1046	0.111	0.051	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
18	Q8CGY8	5.06e-07	54.7	1046	0.111	0.051	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
19	Q9M8Y0	1.20e-05	50.4	977	0.113	0.055	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
20	A0A0R4IVJ0	1.68e-05	50.1	1102	0.105	0.045	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	0.00019	32.9	Anaphase-promoting complex, cyclosome, subunit 3
2	PF12862 ANAPC5	36	15.8	Anaphase-promoting complex subunit 5
3	PF10095 DUF2333	6.5e+02	10.6	Uncharacterized protein conserved in bacteria (DUF2333)
4	PF14088 DUF4268	46	15.4	Domain of unknown function (DUF4268)
5	PF12569 NatA_aux_su	0.15	22.6	N-terminal acetyltransferase A, auxiliary subunit
6	PF10602 RPN7	3.8	18.7	26S proteasome subunit RPN7
7	PF12931 Sec16_C	25	16.0	Sec23-binding domain of Sec16
8	PF08238 Sel1	1.1e+02	15.0	Sel1 repeat
9	PF20308 TPR-S	0.14	24.0	Tetratricopeptide Repeats-Sensor
10	PF00515 TPR_1	6e-16	68.7	Tetratricopeptide repeat
11	PF13374 TPR_10	4.4e-05	34.4	Tetratricopeptide repeat
12	PF13414 TPR_11	4e-13	60.1	TPR repeat
13	PF13424 TPR_12	1.2e-17	75.3	Tetratricopeptide repeat
14	PF13428 TPR_14	1.2e-13	61.6	Tetratricopeptide repeat
15	PF13429 TPR_15	0.0016	29.4	Tetratricopeptide repeat
16	PF13432 TPR_16	5.7e-06	38.1	Tetratricopeptide repeat
17	PF13431 TPR_17	9.5e-07	39.9	Tetratricopeptide repeat
18	PF14559 TPR_19	3.5e-17	73.9	Tetratricopeptide repeat
19	PF07719 TPR_2	3.5e-20	81.5	Tetratricopeptide repeat
20	PF14561 TPR_20	0.62	21.7	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360869

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360883	0.999	Interferon-induced protein with tetratricopeptide repeats 3
2	9606.ENSP00000371471	0.998	Radical S-adenosyl methionine domain-containing protein 2
3	9606.ENSP00000257570	0.997	2'-5'-oligoadenylate synthase-like protein
4	9606.ENSP00000342278	0.996	2'-5'-oligoadenylate synthase 2
5	9606.ENSP00000215794	0.995	Ubl carboxyl-terminal hydrolase 18
6	9606.ENSP00000388001	0.995	2'-5'-oligoadenylate synthase 1
7	9606.ENSP00000228928	0.994	2'-5'-oligoadenylate synthase 3
8	9606.ENSP00000342513	0.994	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
9	9606.ENSP00000360891	0.994	Interferon-induced protein with tetratricopeptide repeats 2
10	9606.ENSP00000368699	0.994	Ubiquitin-like protein ISG15
11	9606.ENSP00000381601	0.994	Interferon-induced GTP-binding protein Mx1
12	9606.ENSP00000380697	0.993	Interferon regulatory factor 7
13	9606.ENSP00000264350	0.992	E3 ISG15--protein ligase HERC5
14	9606.ENSP00000395590	0.989	Interferon-induced 35 kDa protein
15	9606.ENSP00000354822	0.987	XIAP-associated factor 1
16	9606.ENSP00000380073	0.987	Interferon regulatory factor 9
17	9606.ENSP00000386187	0.980	Interferon-induced transmembrane protein 1
18	9606.ENSP00000360860	0.979	Interferon-induced protein with tetratricopeptide repeats 5
19	9606.ENSP00000369213	0.979	Probable ATP-dependent RNA helicase DDX58
20	9606.ENSP00000306565	0.976	Interferon-stimulated gene 20 kDa protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	0.997	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044419	0.995	biological process involved in interspecies interaction between organisms
GO:0009605	0.995	response to external stimulus
GO:0009987	0.988	cellular process
GO:0050789	0.988	regulation of biological process
GO:0009615	0.988	response to virus
GO:0006950	0.957	response to stress
GO:0006952	0.946	defense response
GO:0048518	0.945	positive regulation of biological process
GO:0051607	0.942	defense response to virus
GO:0048519	0.935	negative regulation of biological process
GO:0042221	0.918	response to chemical
GO:1903900	0.897	regulation of viral life cycle
GO:0048525	0.897	negative regulation of viral process
GO:0051716	0.892	cellular response to stimulus
GO:0045071	0.887	negative regulation of viral genome replication
GO:0050794	0.875	regulation of cellular process
GO:0010033	0.861	response to organic substance
GO:0034097	0.809	response to cytokine
GO:0045087	0.754	innate immune response
GO:0071345	0.709	cellular response to cytokine stimulus
GO:0048522	0.535	positive regulation of cellular process
GO:0065009	0.496	regulation of molecular function
GO:0048583	0.457	regulation of response to stimulus
GO:0010646	0.361	regulation of cell communication
GO:0023051	0.349	regulation of signaling
GO:0048584	0.326	positive regulation of response to stimulus
GO:0009966	0.319	regulation of signal transduction
GO:0019222	0.306	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0012505	0.673	endomembrane system
GO:0005634	0.316	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]