StarFunc result for job id P09919

User Input

>input (207 residues)
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09919	1.000	1.000	3.475E-28	207	1.000	1.000	P09919.pdb.gz	CSF3_HUMAN Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1
2	AFDB:P09920	0.786	0.782	1.870E-19	208	0.710	0.707	P09920.pdb.gz	CSF3_MOUSE Granulocyte colony-stimulating factor OS=Mus musculus OX=10090 GN=Csf3 PE=1 SV=1
3	AFDB:P97712	0.753	0.729	1.658E-18	214	0.710	0.687	P97712.pdb.gz	P97712_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=2 SV=1
4	PDB:1rhgB	0.661	0.939	5.109E-16	144	0.691	0.993	1rhgB.pdb.gz
5	PDB:1gncA	0.599	0.688	9.786E-16	175	0.836	0.989	1gncA.pdb.gz
6	AFDB:P47873	0.601	0.623	6.046E-6	199	0.222	0.231	P47873.pdb.gz	IL11_MOUSE Interleukin-11 OS=Mus musculus OX=10090 GN=Il11 PE=1 SV=1
7	AFDB:P20809	0.593	0.615	9.618E-6	199	0.227	0.236	P20809.pdb.gz	IL11_HUMAN Interleukin-11 OS=Homo sapiens OX=9606 GN=IL11 PE=1 SV=1
8	AFDB:A0A0R4IFC8	0.627	0.600	3.529E-5	217	0.242	0.230	A0A0R4IFC8.pdb.gz
9	AFDB:B8ZHI7	0.521	0.486	4.451E-5	224	0.203	0.188	B8ZHI7.pdb.gz	B8ZHI7_DANRE Colony-stimulating factor 3 (granulocyte) a OS=Danio rerio OX=7955 GN=gcsf PE=2 SV=1
10	AFDB:P05231	0.620	0.607	4.663E-5	212	0.159	0.156	P05231.pdb.gz	IL6_HUMAN Interleukin-6 OS=Homo sapiens OX=9606 GN=IL6 PE=1 SV=1
11	AFDB:P26893	0.579	0.566	8.932E-5	212	0.164	0.160	P26893.pdb.gz	IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 PE=2 SV=2
12	AFDB:P20607	0.601	0.590	1.488E-4	211	0.140	0.137	P20607.pdb.gz	IL6_RAT Interleukin-6 OS=Rattus norvegicus OX=10116 GN=Il6 PE=2 SV=1
13	PDB:6o4oA	0.568	0.684	4.217E-4	169	0.193	0.237	6o4oA.pdb.gz
14	PDB:4cniC	0.623	0.742	5.572E-4	171	0.150	0.181	4cniC.pdb.gz
15	PDB:1cnt1	0.527	0.712	7.858E-3	150	0.169	0.233	1cnt1.pdb.gz
16	PDB:1cnt2	0.519	0.805	9.462E-3	130	0.164	0.262	1cnt2.pdb.gz
17	PDB:1f6fA	0.423	0.468	1.250E-2	183	0.121	0.137	1f6fA.pdb.gz
18	PDB:2q7nB	0.545	0.613	2.753E-2	180	0.106	0.122	2q7nB.pdb.gz
19	PDB:2l3yA	0.472	0.514	3.020E-2	184	0.121	0.136	2l3yA.pdb.gz
20	PDB:4zs7A	0.500	0.725	4.379E-2	139	0.121	0.180	4zs7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09919	4.43e-147	409	207	1.000	1.000	CSF3_HUMAN Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1
2	Q8N4W3	1.63e-132	372	200	0.923	0.955	Q8N4W3_HUMAN Granulocyte colony-stimulating factor OS=Homo sapiens OX=9606 GN=CSF3 PE=1 SV=1
3	P09920	7.63e-94	274	208	0.725	0.721	CSF3_MOUSE Granulocyte colony-stimulating factor OS=Mus musculus OX=10090 GN=Csf3 PE=1 SV=1
4	F7FGY7	1.33e-93	273	208	0.725	0.721	F7FGY7_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=3 SV=1
5	P97712	3.17e-92	270	214	0.710	0.687	P97712_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=2 SV=1
6	A0A8I6AAV9	1.42e-89	263	203	0.691	0.704	A0A8I6AAV9_RAT Granulocyte colony-stimulating factor OS=Rattus norvegicus OX=10116 GN=Csf3 PE=3 SV=1
7	P26893	3.25e-04	42.4	212	0.174	0.170	IL6_PIG Interleukin-6 OS=Sus scrofa OX=9823 GN=IL6 PE=2 SV=2
8	Q90YI0	0.001	40.8	241	0.169	0.145	IL6_CHICK Interleukin-6 OS=Gallus gallus OX=9031 GN=IL6 PE=2 SV=1
9	Q9WTN0	0.45	33.5	300	0.130	0.090	GGPPS_MOUSE Geranylgeranyl pyrophosphate synthase OS=Mus musculus OX=10090 GN=Ggps1 PE=1 SV=1
10	P56966	0.49	33.1	300	0.130	0.090	GGPPS_BOVIN Geranylgeranyl pyrophosphate synthase OS=Bos taurus OX=9913 GN=GGPS1 PE=1 SV=2
11	B8ZHI7	0.59	32.7	224	0.140	0.129	B8ZHI7_DANRE Colony-stimulating factor 3 (granulocyte) a OS=Danio rerio OX=7955 GN=gcsf PE=2 SV=1
12	I6Y946	0.87	32.3	245	0.087	0.073	I6Y946_MYCTU Conserved protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0925c PE=1 SV=1
13	A0A0G2K069	1.3	32.3	1736	0.106	0.013	A0A0G2K069_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
14	A0A8I6AUU9	1.3	32.3	1689	0.106	0.013	A0A8I6AUU9_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
15	B7TXY8	1.3	31.6	208	0.179	0.178	B7TXY8_SHEEP Interleukin-6 OS=Ovis aries OX=9940 PE=3 SV=1
16	F6T0B3	1.3	32.3	1629	0.106	0.014	F6T0B3_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=2
17	P29455	1.3	31.6	208	0.179	0.178	IL6_SHEEP Interleukin-6 OS=Ovis aries OX=9940 GN=IL6 PE=2 SV=2
18	Q4Q2E8	1.3	32.3	2628	0.106	0.008	Q4Q2E8_LEIMA non-specific serine/threonine protein kinase OS=Leishmania major OX=5664 GN=TOR3 PE=3 SV=1
19	A0A8I5ZM36	1.4	32.3	1715	0.106	0.013	A0A8I5ZM36_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1
20	A0A8I5ZR92	1.4	32.3	1676	0.106	0.013	A0A8I5ZR92_RAT Collagen type XI alpha 2 chain OS=Rattus norvegicus OX=10116 GN=Col11a2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16647 GCSF	2e-89	308.6	Granulocyte colony-stimulating factor
2	PF07400 IL11	0.54	21.4	Interleukin 11
3	PF05046 Img2	2.7e+02	13.2	Mitochondrial large subunit ribosomal protein (Img2)
4	PF05089 NAGLU	1.9e+02	12.4	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225474

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362195	0.999	Granulocyte colony-stimulating factor receptor
2	9606.ENSP00000296871	0.992	Granulocyte-macrophage colony-stimulating factor
3	9606.ENSP00000385675	0.990	Interleukin-6
4	9606.ENSP00000263339	0.987	Interleukin-1 alpha
5	9606.ENSP00000263341	0.987	Interleukin-1 beta
6	9606.ENSP00000306512	0.987	Interleukin-8
7	9606.ENSP00000477908	0.986	C-C motif chemokine 3
8	9606.ENSP00000482259	0.986	C-C motif chemokine 4
9	9606.ENSP00000398698	0.985	Tumor necrosis factor
10	9606.ENSP00000225831	0.984	C-C motif chemokine 2
11	9606.ENSP00000412237	0.984	Interleukin-10
12	9606.ENSP00000474412	0.983	C-C motif chemokine 5
13	9606.ENSP00000228280	0.982	Kit ligand
14	9606.ENSP00000379110	0.982	Growth-regulated alpha protein
15	9606.ENSP00000305651	0.980	C-X-C motif chemokine 10
16	9606.ENSP00000427279	0.976	C-X-C motif chemokine 2
17	9606.ENSP00000252723	0.968	Erythropoietin
18	9606.ENSP00000204615	0.966	Thrombopoietin
19	9606.ENSP00000249075	0.965	Leukemia inhibitory factor
20	9606.ENSP00000280357	0.964	Interleukin-18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	1.000	receptor ligand activity
GO:0005126	0.984	cytokine receptor binding
GO:0070851	0.906	growth factor receptor binding
GO:0005125	0.595	cytokine activity
GO:0005130	0.581	granulocyte colony-stimulating factor receptor binding
GO:0019899	0.413	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.984	cellular response to stimulus
GO:0048522	0.982	positive regulation of cellular process
GO:0042221	0.974	response to chemical
GO:0010033	0.937	response to organic substance
GO:0048523	0.900	negative regulation of cellular process
GO:0008284	0.883	positive regulation of cell population proliferation
GO:0042327	0.876	positive regulation of phosphorylation
GO:0001934	0.873	positive regulation of protein phosphorylation
GO:0071310	0.870	cellular response to organic substance
GO:0050730	0.853	regulation of peptidyl-tyrosine phosphorylation
GO:0048583	0.808	regulation of response to stimulus
GO:0048584	0.769	positive regulation of response to stimulus
GO:0051130	0.757	positive regulation of cellular component organization
GO:0051239	0.744	regulation of multicellular organismal process
GO:0023051	0.735	regulation of signaling
GO:0010646	0.735	regulation of cell communication
GO:0009966	0.734	regulation of signal transduction
GO:0065008	0.715	regulation of biological quality
GO:1902531	0.710	regulation of intracellular signal transduction
GO:0002682	0.681	regulation of immune system process
GO:0023056	0.662	positive regulation of signaling
GO:0010647	0.662	positive regulation of cell communication
GO:0010468	0.646	regulation of gene expression
GO:1902903	0.637	regulation of supramolecular fiber organization
GO:0009967	0.628	positive regulation of signal transduction
GO:0050731	0.625	positive regulation of peptidyl-tyrosine phosphorylation
GO:1902533	0.622	positive regulation of intracellular signal transduction
GO:0009605	0.621	response to external stimulus
GO:0032956	0.606	regulation of actin cytoskeleton organization
GO:0071840	0.597	cellular component organization or biogenesis
GO:0016043	0.582	cellular component organization
GO:0044087	0.575	regulation of cellular component biogenesis
GO:0051495	0.530	positive regulation of cytoskeleton organization
GO:0050793	0.522	regulation of developmental process
GO:0007154	0.513	cell communication
GO:0019219	0.513	regulation of nucleobase-containing compound metabolic process
GO:1902905	0.510	positive regulation of supramolecular fiber organization
GO:0023052	0.504	signaling
GO:0110053	0.495	regulation of actin filament organization
GO:0043254	0.481	regulation of protein-containing complex assembly
GO:0010941	0.472	regulation of cell death
GO:0044419	0.470	biological process involved in interspecies interaction between organisms
GO:0051252	0.465	regulation of RNA metabolic process
GO:0065009	0.462	regulation of molecular function
GO:0009607	0.459	response to biotic stimulus
GO:0071345	0.457	cellular response to cytokine stimulus
GO:0007165	0.455	signal transduction
GO:0051707	0.454	response to other organism
GO:0008064	0.453	regulation of actin polymerization or depolymerization
GO:0051240	0.419	positive regulation of multicellular organismal process
GO:0044093	0.399	positive regulation of molecular function
GO:0060548	0.397	negative regulation of cell death
GO:0032271	0.371	regulation of protein polymerization
GO:0009889	0.356	regulation of biosynthetic process
GO:0031326	0.351	regulation of cellular biosynthetic process
GO:0044089	0.344	positive regulation of cellular component biogenesis
GO:0009891	0.342	positive regulation of biosynthetic process
GO:0010556	0.341	regulation of macromolecule biosynthetic process
GO:0031328	0.332	positive regulation of cellular biosynthetic process
GO:0030833	0.325	regulation of actin filament polymerization
GO:0045595	0.306	regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0070013	0.994	intracellular organelle lumen
GO:0005615	0.985	extracellular space
GO:0005737	0.968	cytoplasm
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0031982	0.886	vesicle
GO:0031410	0.874	cytoplasmic vesicle
GO:0012505	0.728	endomembrane system
GO:0071944	0.590	cell periphery
GO:0005886	0.581	plasma membrane
GO:0030139	0.469	endocytic vesicle
GO:0032991	0.464	protein-containing complex
GO:0005764	0.399	lysosome
GO:0071682	0.350	endocytic vesicle lumen
GO:0031981	0.337	nuclear lumen
GO:0005775	0.313	vacuolar lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]