StarFunc result for job id P09923

User Input

>input (528 residues)
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPADA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEIHRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDAIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNESESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLAPPACTTDAAHPVAASLPLLAGTLLLLGASAAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4A2	0.963	0.963	0.000	528	1.000	1.000	A0A024R4A2.pdb.gz
2	AFDB:P05187	0.923	0.911	0.000	535	0.850	0.839	P05187.pdb.gz	PPB1_HUMAN Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2
3	AFDB:P24823	0.920	0.918	3.673E-103	529	0.765	0.764	P24823.pdb.gz	PPBN_MOUSE Alkaline phosphatase, germ cell type OS=Mus musculus OX=10090 GN=Alpg PE=2 SV=2
4	AFDB:Q9JKS8	0.926	0.870	2.210E-102	562	0.773	0.726	Q9JKS8.pdb.gz	Q9JKS8_RAT Alkaline phosphatase OS=Rattus norvegicus OX=10116 GN=Akp3 PE=3 SV=1
5	AFDB:F8VPQ6	0.946	0.901	3.012E-102	554	0.771	0.735	F8VPQ6.pdb.gz	F8VPQ6_MOUSE Alkaline phosphatase OS=Mus musculus OX=10090 GN=Alpi PE=1 SV=1
6	AFDB:P15693	0.944	0.923	3.364E-101	540	0.771	0.754	P15693.pdb.gz	PPBI1_RAT Intestinal-type alkaline phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Alpi PE=1 SV=1
7	PDB:3mk0A	0.908	0.997	1.777E-98	481	0.799	0.877	3mk0A.pdb.gz	Refined structures of placental alkaline phosphatase show a consistent pattern of interactions at the peripheral site.
8	PDB:4kjgA	0.907	0.986	3.722E-93	486	0.731	0.794	4kjgA.pdb.gz	Crystal structure of rat intestinal alkaline phosphatase - Role of crown domain in mammalian alkaline phosphatases.
9	AFDB:P05186	0.882	0.889	7.068E-82	524	0.562	0.567	P05186.pdb.gz	PPBT_HUMAN Alkaline phosphatase, tissue-nonspecific isozyme OS=Homo sapiens OX=9606 GN=ALPL PE=1 SV=4
10	AFDB:P09242	0.882	0.889	2.153E-81	524	0.568	0.573	P09242.pdb.gz	PPBT_MOUSE Alkaline phosphatase, tissue-nonspecific isozyme OS=Mus musculus OX=10090 GN=Alpl PE=1 SV=2
11	AFDB:F1Q5B5	0.883	0.831	4.524E-81	561	0.562	0.529	F1Q5B5.pdb.gz	F1Q5B5_DANRE Alkaline phosphatase OS=Danio rerio OX=7955 GN=Akp2 PE=1 SV=1
12	AFDB:Q92058	0.887	0.902	1.638E-79	519	0.555	0.565	Q92058.pdb.gz	PPBT_CHICK Alkaline phosphatase, tissue-nonspecific isozyme OS=Gallus gallus OX=9031 GN=ALPL PE=1 SV=1
13	PDB:1ajbA	0.617	0.721	2.261E-31	449	0.237	0.278	1ajbA.pdb.gz	3-D structure of the D153G mutant of Escherichia coli alkaline phosphatase: an enzyme with weaker magnesium binding and increased catalytic activity.
14	PDB:1o98A	0.303	0.313	3.309E-8	509	0.140	0.145	1o98A.pdb.gz	Insights Into the Catalytic Mechanism of Cofactor-Independent Phosphoglycerate Mutase from X-Ray Crystallography, Simulated Dynamics and Molecular Modeling
15	PDB:3nvlA	0.321	0.310	4.508E-8	549	0.127	0.122	3nvlA.pdb.gz	Crystal structure of phosphoglycerate mutase from Trypanosoma brucei.
16	PDB:2ifyA	0.284	0.294	5.358E-7	508	0.116	0.120	2ifyA.pdb.gz	Structure and Molecular Mechanism of Bacillus anthracis Cofactor-Independent Phosphoglycerate Mutase: A Crucial Enzyme for Spores and Growing Cells of Bacillus Species.
17	PDB:7tl7A	0.304	0.302	5.700E-7	531	0.142	0.141	7tl7A.pdb.gz	Serum-Stable and Selective Backbone-N-Methylated Cyclic Peptides That Inhibit Prokaryotic Glycolytic Mutases.
18	PDB:1ei6A	0.254	0.316	1.058E-6	404	0.066	0.087	1ei6A.pdb.gz	Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
19	PDB:1n2lA	0.318	0.343	4.129E-6	483	0.102	0.112	1n2lA.pdb.gz	Crystal structure of a covalent intermediate of endogenous human arylsulfatase A.
20	PDB:6wevAbA	0.313	0.217	4.673E-6	817	0.102	0.066	6wevAbA.pdb.gz	Crystal structures of human ENPP1 in apo and bound forms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZL2	0.0	834	558	0.771	0.729	A0A0G2JZL2_RAT Alkaline phosphatase OS=Rattus norvegicus OX=10116 GN=Akp3 PE=3 SV=1
2	F1Q5B5	0.0	594	561	0.545	0.513	F1Q5B5_DANRE Alkaline phosphatase OS=Danio rerio OX=7955 GN=Akp2 PE=1 SV=1
3	F8VPQ6	0.0	857	554	0.763	0.727	F8VPQ6_MOUSE Alkaline phosphatase OS=Mus musculus OX=10090 GN=Alpi PE=1 SV=1
4	P05186	0.0	581	524	0.545	0.550	PPBT_HUMAN Alkaline phosphatase, tissue-nonspecific isozyme OS=Homo sapiens OX=9606 GN=ALPL PE=1 SV=4
5	P05187	0.0	905	535	0.814	0.804	PPB1_HUMAN Alkaline phosphatase, placental type OS=Homo sapiens OX=9606 GN=ALPP PE=1 SV=2
6	P08289	0.0	591	524	0.549	0.553	PPBT_RAT Alkaline phosphatase, tissue-nonspecific isozyme OS=Rattus norvegicus OX=10116 GN=Alpl PE=1 SV=2
7	P09242	0.0	586	524	0.549	0.553	PPBT_MOUSE Alkaline phosphatase, tissue-nonspecific isozyme OS=Mus musculus OX=10090 GN=Alpl PE=1 SV=2
8	P09487	0.0	593	524	0.557	0.561	PPBT_BOVIN Alkaline phosphatase, tissue-nonspecific isozyme OS=Bos taurus OX=9913 GN=ALPL PE=1 SV=2
9	P09923	0.0	1094	528	1.000	1.000	PPBI_HUMAN Intestinal-type alkaline phosphatase OS=Homo sapiens OX=9606 GN=ALPI PE=1 SV=2
10	P10696	0.0	907	532	0.847	0.840	PPBN_HUMAN Alkaline phosphatase, germ cell type OS=Homo sapiens OX=9606 GN=ALPG PE=1 SV=4
11	P15693	0.0	840	540	0.761	0.744	PPBI1_RAT Intestinal-type alkaline phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Alpi PE=1 SV=1
12	P24822	0.0	820	559	0.759	0.717	PPBI_MOUSE Intestinal-type alkaline phosphatase OS=Mus musculus OX=10090 GN=Iap PE=2 SV=1
13	P24823	0.0	838	529	0.748	0.747	PPBN_MOUSE Alkaline phosphatase, germ cell type OS=Mus musculus OX=10090 GN=Alpg PE=2 SV=2
14	Q0VD75	0.0	853	553	0.759	0.725	Q0VD75_MOUSE Alkaline phosphatase (Fragment) OS=Mus musculus OX=10090 GN=Alpi PE=2 SV=1
15	Q29486	0.0	593	524	0.559	0.563	PPBT_FELCA Alkaline phosphatase, tissue-nonspecific isozyme OS=Felis catus OX=9685 GN=ALPL PE=1 SV=1
16	Q92058	0.0	579	519	0.562	0.572	PPBT_CHICK Alkaline phosphatase, tissue-nonspecific isozyme OS=Gallus gallus OX=9031 GN=ALPL PE=1 SV=1
17	Q9JKS8	0.0	833	562	0.771	0.724	Q9JKS8_RAT Alkaline phosphatase OS=Rattus norvegicus OX=10116 GN=Akp3 PE=3 SV=1
18	Q9VP35	2.30e-124	376	523	0.426	0.430	Q9VP35_DROME alkaline phosphatase OS=Drosophila melanogaster OX=7227 GN=Alp1 PE=2 SV=2
19	Q9VHD0	6.32e-123	373	546	0.396	0.383	Q9VHD0_DROME Alkaline phosphatase OS=Drosophila melanogaster OX=7227 GN=phu PE=2 SV=3
20	M9PD70	9.28e-122	369	530	0.426	0.425	M9PD70_DROME alkaline phosphatase OS=Drosophila melanogaster OX=7227 GN=Alp1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00245 Alk_phosphatase	3.8e-184	624.2	Alkaline phosphatase
2	PF01676 Metalloenzyme	1.9e+02	12.8	Metalloenzyme superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295463

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355587	0.920	Cancer-related nucleoside-triphosphatase
2	9606.ENSP00000280362	0.901	6-pyruvoyl tetrahydrobiopterin synthase
3	9606.ENSP00000353165	0.901	Thiamin pyrophosphokinase 1
4	9606.ENSP00000419045	0.900	GTP cyclohydrolase 1
5	9606.ENSP00000258385	0.764	Acetylcholine receptor subunit delta
6	9606.ENSP00000338964	0.764	Glutathione hydrolase 7
7	9606.ENSP00000370962	0.759	Glutathione hydrolase 6
8	9606.ENSP00000243786	0.736	Inhibin alpha chain
9	9606.ENSP00000379823	0.720	Collagen alpha-3(IV) chain
10	9606.ENSP00000381340	0.712	Glutathione hydrolase 5 proenzyme
11	9606.ENSP00000383232	0.699	Glutathione hydrolase 1 proenzyme
12	9606.ENSP00000359539	0.696	Aspartate aminotransferase, cytoplasmic
13	9606.ENSP00000375881	0.696	Alkaline phosphatase, placental
14	9606.ENSP00000302393	0.689	Lactate dehydrogenase A like 6B
15	9606.ENSP00000280706	0.686	L-lactate dehydrogenase A-like 6A
16	9606.ENSP00000315137	0.674	Sphingosine-1-phosphate phosphatase 2
17	9606.ENSP00000295453	0.651	Alkaline phosphatase, placental like 2
18	9606.ENSP00000375921	0.648	Paired box protein Pax-3
19	9606.ENSP00000247225	0.635	Sphingosine-1-phosphate phosphatase 1
20	9606.ENSP00000360296	0.624	Phospholipid phosphatase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004035	1.000	alkaline phosphatase activity
GO:0019899	0.771	enzyme binding
GO:0002020	0.750	protease binding
GO:0043167	0.711	ion binding
GO:0043169	0.583	cation binding
GO:0046872	0.564	metal ion binding
GO:0008270	0.494	zinc ion binding
GO:0000287	0.487	magnesium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0008152	0.967	metabolic process
GO:0044237	0.840	cellular metabolic process
GO:0050896	0.651	response to stimulus
GO:0071704	0.510	organic substance metabolic process
GO:0032501	0.384	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.993	extracellular region
GO:0043227	0.831	membrane-bounded organelle
GO:0031982	0.722	vesicle
GO:0005622	0.523	intracellular anatomical structure
GO:0043229	0.421	intracellular organelle
GO:0043230	0.398	extracellular organelle
GO:0065010	0.363	extracellular membrane-bounded organelle
GO:0043231	0.328	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.1	1.000	alkaline phosphatase.

[back to server]