StarFunc result for job id P0C024

User Input

>input (238 residues)
MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVR
SEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTL
ITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRLGHRFINHIFEYTNP
EDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C024	1.000	1.000	6.576E-53	238	1.000	1.000	P0C024.pdb.gz	NUDT7_HUMAN Peroxisomal coenzyme A diphosphatase NUDT7 OS=Homo sapiens OX=9606 GN=NUDT7 PE=1 SV=1
2	PDB:5t3pC	0.917	0.987	8.385E-45	221	0.924	0.995	5t3pC.pdb.gz
3	AFDB:Q99P30	0.963	0.971	7.058E-40	236	0.647	0.653	Q99P30.pdb.gz	NUDT7_MOUSE Peroxisomal coenzyme A diphosphatase NUDT7 OS=Mus musculus OX=10090 GN=Nudt7 PE=1 SV=2
4	AFDB:Q8LET2	0.788	0.842	8.332E-23	222	0.282	0.302	Q8LET2.pdb.gz	NUD11_ARATH Nudix hydrolase 11 OS=Arabidopsis thaliana OX=3702 GN=NUDT11 PE=1 SV=2
5	AFDB:Q8GYB1	0.744	0.626	4.024E-21	285	0.303	0.253	Q8GYB1.pdb.gz	NUD15_ARATH Nudix hydrolase 15, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NUDT15 PE=1 SV=2
6	AFDB:P43337	0.671	0.818	4.374E-20	192	0.277	0.344	P43337.pdb.gz	NUDL_ECOLI Uncharacterized Nudix hydrolase NudL OS=Escherichia coli (strain K12) OX=83333 GN=nudL PE=3 SV=1
7	AFDB:Q9NA25	0.707	0.719	3.324E-19	234	0.315	0.321	Q9NA25.pdb.gz	NDX8_CAEEL Peroxisomal coenzyme A diphosphatase ndx-8 OS=Caenorhabditis elegans OX=6239 GN=ndx-8 PE=1 SV=1
8	AFDB:Q12524	0.707	0.510	1.586E-15	340	0.223	0.156	Q12524.pdb.gz	PCD1_YEAST Peroxisomal coenzyme A diphosphatase 1, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCD1 PE=1 SV=1
9	AFDB:Q9CR24	0.635	0.711	1.787E-15	210	0.277	0.314	Q9CR24.pdb.gz	NUDT8_MOUSE Mitochondrial coenzyme A diphosphatase NUDT8 OS=Mus musculus OX=10090 GN=Nudt8 PE=1 SV=1
10	AFDB:Q9RV46	0.641	0.773	6.639E-15	194	0.227	0.278	Q9RV46.pdb.gz	Y1184_DEIRA Nudix hydrolase DR_1184 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_1184 PE=1 SV=1
11	AFDB:Q92350	0.611	0.519	5.685E-14	285	0.235	0.196	Q92350.pdb.gz	YDH5_SCHPO Probable nudix hydrolase C6G9.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G9.05 PE=3 SV=1
12	PDB:1nqzA	0.540	0.733	1.013E-11	171	0.231	0.322	1nqzA.pdb.gz
13	PDB:1ktgA	0.417	0.698	2.567E-7	137	0.092	0.161	1ktgA.pdb.gz	The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms
14	PDB:7b66A	0.371	0.520	3.991E-6	161	0.097	0.143	7b66A.pdb.gz	Crystal structures of NUDT15 variants enabled by a potent inhibitor reveal the structural basis for thiopurine sensitivity.
15	PDB:2gb5A	0.335	0.305	4.497E-6	265	0.076	0.068	2gb5A.pdb.gz	Crystal structure of NADH pyrophosphatase (EC 3.6.1.22) (1790429) from Escherichia coli K12 at 2.30 A resolution
16	PDB:2i6kA	0.343	0.361	4.774E-6	224	0.092	0.098	2i6kA.pdb.gz	Crystal structures of human IPP isomerase: new insights into the catalytic mechanism
17	PDB:5gp0I	0.342	0.546	7.247E-6	139	0.059	0.101	5gp0I.pdb.gz	Structural Insights into the Substrate Recognition Mechanism of Arabidopsis GPP-Bound NUDX1 for Noncanonical Monoterpene Biosynthesis.
18	PDB:3gz6A	0.367	0.396	7.693E-6	219	0.118	0.128	3gz6A.pdb.gz	Structure and function of an ADP-ribose-dependent transcriptional regulator of NAD metabolism
19	PDB:2fkbC	0.373	0.511	8.668E-6	167	0.080	0.114	2fkbC.pdb.gz
20	PDB:5cfiA	0.405	0.629	9.200E-6	147	0.088	0.143	5cfiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C024	5.53e-178	489	238	1.000	1.000	NUDT7_HUMAN Peroxisomal coenzyme A diphosphatase NUDT7 OS=Homo sapiens OX=9606 GN=NUDT7 PE=1 SV=1
2	Q99P30	2.82e-108	313	236	0.647	0.653	NUDT7_MOUSE Peroxisomal coenzyme A diphosphatase NUDT7 OS=Mus musculus OX=10090 GN=Nudt7 PE=1 SV=2
3	Q8LET2	2.98e-31	116	222	0.273	0.293	NUD11_ARATH Nudix hydrolase 11 OS=Arabidopsis thaliana OX=3702 GN=NUDT11 PE=1 SV=2
4	Q8GYB1	2.49e-27	107	285	0.269	0.225	NUD15_ARATH Nudix hydrolase 15, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NUDT15 PE=1 SV=2
5	Q9NA25	5.30e-19	84.7	234	0.269	0.274	NDX8_CAEEL Peroxisomal coenzyme A diphosphatase ndx-8 OS=Caenorhabditis elegans OX=6239 GN=ndx-8 PE=1 SV=1
6	Q92350	3.08e-16	78.2	285	0.185	0.154	YDH5_SCHPO Probable nudix hydrolase C6G9.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G9.05 PE=3 SV=1
7	Q9CR24	1.68e-15	74.7	210	0.244	0.276	NUDT8_MOUSE Mitochondrial coenzyme A diphosphatase NUDT8 OS=Mus musculus OX=10090 GN=Nudt8 PE=1 SV=1
8	P43337	2.21e-12	65.9	192	0.277	0.344	NUDL_ECOLI Uncharacterized Nudix hydrolase NudL OS=Escherichia coli (strain K12) OX=83333 GN=nudL PE=3 SV=1
9	Q12524	1.01e-08	57.0	340	0.189	0.132	PCD1_YEAST Peroxisomal coenzyme A diphosphatase 1, peroxisomal OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCD1 PE=1 SV=1
10	O69640	2.05e-08	55.8	273	0.160	0.139	O69640_MYCTO Nudix hydrolase domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3773 PE=3 SV=1
11	Q9RV46	3.77e-08	53.9	194	0.164	0.201	Y1184_DEIRA Nudix hydrolase DR_1184 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_1184 PE=1 SV=1
12	O13717	0.002	41.2	329	0.155	0.112	YDZA_SCHPO Uncharacterized protein C14C4.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC14C4.10c PE=4 SV=1
13	Q9NY59	0.99	33.1	655	0.113	0.041	NSMA2_HUMAN Sphingomyelin phosphodiesterase 3 OS=Homo sapiens OX=9606 GN=SMPD3 PE=1 SV=1
14	P50583	1.6	31.2	147	0.063	0.102	AP4A_HUMAN Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Homo sapiens OX=9606 GN=NUDT2 PE=1 SV=3
15	Q9NVD3	1.7	32.3	440	0.109	0.059	SETD4_HUMAN SET domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SETD4 PE=1 SV=1
16	A0A8I6A2S5	1.8	32.3	4402	0.109	0.006	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
17	A0A8I6ASH2	1.8	32.3	4387	0.109	0.006	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
18	F1LTJ5	1.8	32.3	2438	0.109	0.011	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
19	P09471	1.8	32.0	354	0.092	0.062	GNAO_HUMAN Guanine nucleotide-binding protein G(o) subunit alpha OS=Homo sapiens OX=9606 GN=GNAO1 PE=1 SV=4
20	P76417	1.8	32.0	425	0.059	0.033	YEGT_ECOLI Putative nucleoside transporter YegT OS=Escherichia coli (strain K12) OX=83333 GN=yegT PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00293 NUDIX	2.2e-07	42.4	NUDIX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268533

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380251	0.970	Nucleoside diphosphate-linked moiety X motif 19
2	9606.ENSP00000363614	0.945	Hydroxymethylglutaryl-CoA lyase, mitochondrial
3	9606.ENSP00000259407	0.933	Bile acid-CoA:amino acid N-acyltransferase
4	9606.ENSP00000278060	0.930	Peroxisomal N(1)-acetyl-spermine/spermidine oxidase
5	9606.ENSP00000238651	0.928	Acyl-coenzyme A thioesterase 2, mitochondrial
6	9606.ENSP00000293217	0.925	Peroxisomal acyl-coenzyme A oxidase 1
7	9606.ENSP00000307697	0.922	Peroxisomal acyl-coenzyme A oxidase 2
8	9606.ENSP00000368066	0.920	Hydroxyacid oxidase 1
9	9606.ENSP00000315013	0.919	Carnitine O-acetyltransferase
10	9606.ENSP00000323071	0.919	Acyl-coenzyme A thioesterase 4
11	9606.ENSP00000430269	0.919	Bifunctional epoxide hydrolase 2
12	9606.ENSP00000221418	0.918	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
13	9606.ENSP00000413575	0.918	Peroxisomal carnitine O-octanoyltransferase
14	9606.ENSP00000420914	0.918	Peroxisomal multifunctional enzyme type 2
15	9606.ENSP00000231887	0.917	Peroxisomal bifunctional enzyme
16	9606.ENSP00000431049	0.917	Soluble glutathione S-transferases
17	9606.ENSP00000287078	0.915	Peroxisomal leader peptide-processing protease
18	9606.ENSP00000369461	0.910	Enoyl-CoA delta isomerase 2, mitochondrial
19	9606.ENSP00000483507	0.908	Hydroxyacid oxidase 2
20	9606.ENSP00000217455	0.906	Acyl-coenzyme A thioesterase 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016462	1.000	pyrophosphatase activity
GO:0000287	1.000	magnesium ion binding
GO:1901363	0.995	heterocyclic compound binding
GO:0097159	0.995	organic cyclic compound binding
GO:0030515	0.993	snoRNA binding
GO:0005515	0.717	protein binding
GO:0010945	0.689	CoA pyrophosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009154	0.997	purine ribonucleotide catabolic process
GO:0033875	0.996	ribonucleoside bisphosphate metabolic process
GO:0034032	0.996	purine nucleoside bisphosphate metabolic process
GO:0015936	0.993	coenzyme A metabolic process
GO:0006631	0.990	fatty acid metabolic process
GO:0072329	0.990	monocarboxylic acid catabolic process
GO:0009062	0.979	fatty acid catabolic process
GO:0006637	0.959	acyl-CoA metabolic process
GO:0044273	0.945	sulfur compound catabolic process
GO:1901568	0.916	fatty acid derivative metabolic process
GO:0035337	0.819	fatty-acyl-CoA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005782	1.000	peroxisomal matrix
GO:0005829	0.994	cytosol
GO:0031981	0.333	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	1.000	In phosphorus-containing anhydrides.

[back to server]