StarFunc result for job id P0C025

User Input

>input (328 residues)
MAEVRVQLLLSRRPESVSFARSVCGLLGAGPGLGTWPIHCSLKRGRLVLSSRPFPGASAR
LPLQRPPFCPFAALEERPRVPGAELPTDRGVDLGVAVILQSSDKTVLLTRRARTLSVSPN
LWVPPGGHVELEEELLDGGLRELWEESGLHLPQGQFSWVPLGLWESAYPPRLSWGLPKYH
HIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPDVAAAVAAAEDGTETPGLLPQDLP
PSVLAVELEEDGRARPLVLHMSTLLRMIPTMAEDKERVSTGTKFALKLWLQHLGRTPPPC
KSAAYLDPGPAKEEWNMDPLPPNQGSGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5BE28	0.328	0.628	8.285E-9	163	0.098	0.196	Q5BE28.pdb.gz	Q5BE28_EMENI NUDIX domain, putative (AFU_orthologue AFUA_5G13840) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01202 PE=3 SV=1
2	AFDB:Q9NV35	0.314	0.601	1.124E-8	164	0.095	0.189	Q9NV35.pdb.gz	NUD15_HUMAN Nucleotide triphosphate diphosphatase NUDT15 OS=Homo sapiens OX=9606 GN=NUDT15 PE=1 SV=1
3	AFDB:Q8BG93	0.314	0.582	1.194E-8	170	0.095	0.182	Q8BG93.pdb.gz	NUD15_MOUSE Nucleotide triphosphate diphosphatase NUDT15 OS=Mus musculus OX=10090 GN=Nudt15 PE=1 SV=1
4	PDB:7b66A	0.305	0.590	1.537E-8	161	0.095	0.193	7b66A.pdb.gz	Crystal structures of NUDT15 variants enabled by a potent inhibitor reveal the structural basis for thiopurine sensitivity.
5	AFDB:Q9RY71	0.300	0.532	2.638E-8	171	0.122	0.234	Q9RY71.pdb.gz	Y079_DEIRA Nudix hydrolase DR_0079 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_0079 PE=1 SV=1
6	AFDB:Q8GYB1	0.346	0.392	2.804E-8	285	0.107	0.123	Q8GYB1.pdb.gz	NUD15_ARATH Nudix hydrolase 15, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NUDT15 PE=1 SV=2
7	AFDB:P0C024	0.337	0.450	2.980E-8	238	0.101	0.139	P0C024.pdb.gz	NUDT7_HUMAN Peroxisomal coenzyme A diphosphatase NUDT7 OS=Homo sapiens OX=9606 GN=NUDT7 PE=1 SV=1
8	AFDB:Q8PTX6	0.308	0.562	4.853E-8	170	0.076	0.147	Q8PTX6.pdb.gz	PRDPP_METMA Prenyl-diphosphate phosphatase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) OX=192952 GN=MM_2582 PE=1 SV=1
9	PDB:5gp0I	0.304	0.678	5.203E-8	139	0.076	0.180	5gp0I.pdb.gz	Structural Insights into the Substrate Recognition Mechanism of Arabidopsis GPP-Bound NUDX1 for Noncanonical Monoterpene Biosynthesis.
10	AFDB:Q9RV46	0.293	0.466	5.827E-8	194	0.113	0.191	Q9RV46.pdb.gz	Y1184_DEIRA Nudix hydrolase DR_1184 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_1184 PE=1 SV=1
11	AFDB:P43337	0.363	0.593	6.193E-8	192	0.101	0.172	P43337.pdb.gz	NUDL_ECOLI Uncharacterized Nudix hydrolase NudL OS=Escherichia coli (strain K12) OX=83333 GN=nudL PE=3 SV=1
12	PDB:2gt4A	0.279	0.512	6.247E-8	160	0.091	0.188	2gt4A.pdb.gz	X-ray, NMR, and mutational studies of the catalytic cycle of the GDP-mannose mannosyl hydrolase reaction.
13	AFDB:Q9CA40	0.311	0.662	6.997E-8	147	0.076	0.170	Q9CA40.pdb.gz	NUDT1_ARATH Nudix hydrolase 1 OS=Arabidopsis thaliana OX=3702 GN=NUDT1 PE=1 SV=1
14	PDB:5t3pC	0.340	0.488	9.006E-8	221	0.107	0.158	5t3pC.pdb.gz
15	PDB:2fkbC	0.298	0.554	9.572E-8	167	0.079	0.156	2fkbC.pdb.gz
16	PDB:1vc8A	0.284	0.691	4.394E-7	126	0.091	0.238	1vc8A.pdb.gz	Crystal Structure of Nudix Protein Ndx1 from Thermus thermophilus HB8 in binary complex with diadenosine hexaphosphate
17	PDB:5louB	0.351	0.379	1.316E-6	301	0.137	0.150	5louB.pdb.gz	Human NUDT22 Is a UDP-Glucose/Galactose Hydrolase Exhibiting a Unique Structural Fold.
18	PDB:2gb5A	0.266	0.324	1.487E-6	265	0.073	0.091	2gb5A.pdb.gz	Crystal structure of NADH pyrophosphatase (EC 3.6.1.22) (1790429) from Escherichia coli K12 at 2.30 A resolution
19	PDB:4zbpB	0.270	0.321	1.487E-6	270	0.079	0.096	4zbpB.pdb.gz	Crystal Structures of Arabidopsis thaliana Nudix Hydrolase NUDT7 Reveal a Previously Unobserved Conformation.
20	PDB:2o1cA	0.303	0.623	1.898E-6	147	0.079	0.177	2o1cA.pdb.gz	Structure and function of the E. coli dihydroneopterin triphosphate pyrophosphatase: a Nudix enzyme involved in folate biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q38929	3.44e-04	43.9	291	0.134	0.151	IDI1_ARATH Isopentenyl-diphosphate Delta-isomerase I, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPP1 PE=1 SV=3
2	Q5BE28	0.002	40.4	163	0.076	0.153	Q5BE28_EMENI NUDIX domain, putative (AFU_orthologue AFUA_5G13840) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01202 PE=3 SV=1
3	P0AEI6	0.006	38.9	153	0.046	0.098	NUDJ_ECOLI Phosphatase NudJ OS=Escherichia coli (strain K12) OX=83333 GN=nudJ PE=1 SV=1
4	Q8NFP7	0.006	39.3	164	0.079	0.159	NUD10_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Homo sapiens OX=9606 GN=NUDT10 PE=1 SV=1
5	Q8R2U6	0.033	37.4	179	0.076	0.140	NUDT4_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Mus musculus OX=10090 GN=Nudt4 PE=1 SV=1
6	Q9NZJ9	0.038	37.0	180	0.076	0.139	NUDT4_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4 PE=1 SV=2
7	Q42553	0.047	37.4	284	0.134	0.155	IDI2_ARATH Isopentenyl-diphosphate Delta-isomerase II, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=IPP2 PE=1 SV=1
8	Q9NV35	0.052	36.6	164	0.085	0.171	NUD15_HUMAN Nucleotide triphosphate diphosphatase NUDT15 OS=Homo sapiens OX=9606 GN=NUDT15 PE=1 SV=1
9	O95989	0.054	36.6	172	0.076	0.145	NUDT3_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Homo sapiens OX=9606 GN=NUDT3 PE=1 SV=1
10	A0A024RBG1	0.057	36.6	181	0.076	0.138	NUD4B_HUMAN Diphosphoinositol polyphosphate phosphohydrolase NUDT4B OS=Homo sapiens OX=9606 GN=NUDT4B PE=3 SV=1
11	Q96G61	0.058	36.2	164	0.076	0.152	NUD11_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Homo sapiens OX=9606 GN=NUDT11 PE=1 SV=1
12	O35066	0.072	37.4	796	0.070	0.029	KIF3C_MOUSE Kinesin-like protein KIF3C OS=Mus musculus OX=10090 GN=Kif3c PE=1 SV=3
13	P93740	0.075	37.0	280	0.055	0.064	NUD23_ARATH Nudix hydrolase 23, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=NUDT23 PE=1 SV=2
14	Q8BG93	0.077	36.2	170	0.082	0.159	NUD15_MOUSE Nucleotide triphosphate diphosphatase NUDT15 OS=Mus musculus OX=10090 GN=Nudt15 PE=1 SV=1
15	P53370	0.079	37.0	316	0.067	0.070	NUDT6_HUMAN Nucleoside diphosphate-linked moiety X motif 6 OS=Homo sapiens OX=9606 GN=NUDT6 PE=1 SV=2
16	Q8L7W2	0.085	37.0	369	0.067	0.060	NUDT8_ARATH Nudix hydrolase 8 OS=Arabidopsis thaliana OX=3702 GN=NUDT8 PE=2 SV=2
17	P32056	0.088	35.8	159	0.131	0.270	GMM_ECOLI GDP-mannose mannosyl hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=gmm PE=1 SV=2
18	Q7JVG2	0.089	35.8	177	0.076	0.141	Q7JVG2_DROME diphosphoinositol-polyphosphate diphosphatase OS=Drosophila melanogaster OX=7227 GN=Aps PE=1 SV=1
19	P0C027	0.13	35.4	164	0.073	0.146	NUD10_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-alpha OS=Mus musculus OX=10090 GN=Nudt10 PE=1 SV=1
20	P0C028	0.13	35.4	164	0.073	0.146	NUD11_MOUSE Diphosphoinositol polyphosphate phosphohydrolase 3-beta OS=Mus musculus OX=10090 GN=Nudt11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00293 NUDIX	2.3e-13	61.7	NUDIX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000334437

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230792	0.880	Peroxisomal NADH pyrophosphatase NUDT12
2	9606.ENSP00000480722	0.870	8-oxo-dGDP phosphatase NUDT18
3	9606.ENSP00000279206	0.853	Nucleoside diphosphate-linked moiety X motif 22
4	9606.ENSP00000419628	0.833	ADP-sugar pyrophosphatase
5	9606.ENSP00000376349	0.809	Uridine diphosphate glucose pyrophosphatase
6	9606.ENSP00000364166	0.791	Transmembrane protein 225
7	9606.ENSP00000306070	0.790	Nucleoside diphosphate-linked moiety X motif 6
8	9606.ENSP00000338352	0.789	Diphosphoinositol polyphosphate phosphohydrolase 2
9	9606.ENSP00000411565	0.781	Dehydrogenase/reductase SDR family member 12
10	9606.ENSP00000303575	0.742	ADP-ribose pyrophosphatase, mitochondrial
11	9606.ENSP00000422375	0.737	U8 snoRNA-decapping enzyme
12	9606.ENSP00000327234	0.736	Transmembrane and coiled-coil domains 5A
13	9606.ENSP00000300291	0.719	Cleavage and polyadenylation specificity factor subunit 5
14	9606.ENSP00000257604	0.707	TRAF-type zinc finger domain-containing protein 1
15	9606.ENSP00000476119	0.697	Diphosphoinositol polyphosphate phosphohydrolase 1
16	9606.ENSP00000380251	0.687	Nucleoside diphosphate-linked moiety X motif 19
17	9606.ENSP00000258662	0.683	Nucleotide triphosphate diphosphatase NUDT15
18	9606.ENSP00000368455	0.663	Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
19	9606.ENSP00000331152	0.658	Max-interacting protein 1
20	9606.ENSP00000365160	0.629	Diphosphoinositol polyphosphate phosphohydrolase 3-beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016462	0.999	pyrophosphatase activity
GO:0005488	0.996	binding
GO:0005515	0.993	protein binding
GO:0043169	0.745	cation binding
GO:0046872	0.724	metal ion binding
GO:0000287	0.560	magnesium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.989	primary metabolic process
GO:0009056	0.965	catabolic process
GO:0006807	0.965	nitrogen compound metabolic process
GO:1901360	0.946	organic cyclic compound metabolic process
GO:0034641	0.946	cellular nitrogen compound metabolic process
GO:0019439	0.935	aromatic compound catabolic process
GO:0046483	0.923	heterocycle metabolic process
GO:0006139	0.910	nucleobase-containing compound metabolic process
GO:1901575	0.902	organic substance catabolic process
GO:0034655	0.880	nucleobase-containing compound catabolic process
GO:1901292	0.845	nucleoside phosphate catabolic process
GO:1901565	0.822	organonitrogen compound catabolic process
GO:0009166	0.816	nucleotide catabolic process
GO:0065007	0.574	biological regulation
GO:0050789	0.552	regulation of biological process
GO:0072521	0.393	purine-containing compound metabolic process
GO:0006163	0.360	purine nucleotide metabolic process
GO:0072523	0.354	purine-containing compound catabolic process
GO:0050794	0.315	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043227	0.973	membrane-bounded organelle
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0005634	0.928	nucleus
GO:0043233	0.908	organelle lumen
GO:0005829	0.894	cytosol
GO:0070013	0.883	intracellular organelle lumen
GO:0031981	0.478	nuclear lumen
GO:0005654	0.350	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.999	In phosphorus-containing anhydrides.

[back to server]