StarFunc result for job id P0C0L4

User Input

>input (1744 residues)
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN
PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDS
LSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVEN
SHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPN
FEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSW
YFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD
IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDS
RPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPS
FYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQW
TLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRA
ARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPE
NWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP
MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
VVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEI
PGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAP
TLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTA
FVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVA
LTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYAL
TLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL
WIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASH
TTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKV
LRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTP
LQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYY
NPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYY
PRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG
KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQ
GCQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B8JKW4	0.615	0.649	0.000	1643	0.278	0.295	B8JKW4.pdb.gz
2	AFDB:P01024	0.444	0.462	0.000	1663	0.278	0.291	P01024.pdb.gz	CO3_HUMAN Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2
3	AFDB:P01025	0.456	0.475	0.000	1661	0.279	0.293	P01025.pdb.gz	CO3_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=2
4	AFDB:P01026	0.447	0.465	0.000	1663	0.280	0.294	P01026.pdb.gz	CO3_RAT Complement C3 OS=Rattus norvegicus OX=10116 GN=C3 PE=1 SV=3
5	AFDB:P01029	0.969	0.973	0.000	1738	0.761	0.764	P01029.pdb.gz	CO4B_MOUSE Complement C4-B OS=Mus musculus OX=10090 GN=C4b PE=1 SV=3
6	AFDB:P08649	0.977	0.981	0.000	1737	0.796	0.800	P08649.pdb.gz	CO4_RAT Complement C4 OS=Rattus norvegicus OX=10116 GN=C4 PE=1 SV=3
7	AFDB:P0C0L4	1.000	1.000	0.000	1744	1.000	1.000	P0C0L4.pdb.gz	CO4A_HUMAN Complement C4-A OS=Homo sapiens OX=9606 GN=C4A PE=1 SV=2
8	AFDB:P98093	0.531	0.563	0.000	1640	0.283	0.301	P98093.pdb.gz	CO3_ONCMY Complement C3 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=c3 PE=1 SV=1
9	AFDB:Q91132	0.538	0.568	0.000	1642	0.273	0.290	Q91132.pdb.gz	VCO3_NAJKA Cobra venom factor OS=Naja kaouthia OX=8649 PE=1 SV=1
10	AFDB:P01031	0.443	0.459	3.526E-101	1676	0.255	0.265	P01031.pdb.gz	CO5_HUMAN Complement C5 OS=Homo sapiens OX=9606 GN=C5 PE=1 SV=4
11	PDB:7nycA	0.533	0.594	1.073E-86	1542	0.235	0.265	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
12	PDB:7q1yA	0.340	0.418	6.817E-70	1374	0.184	0.234	7q1yA.pdb.gz
13	PDB:6h03A	0.468	0.651	4.621E-69	1223	0.188	0.268	6h03A.pdb.gz
14	PDB:7vonA	0.351	0.427	2.576E-66	1399	0.197	0.246	7vonA.pdb.gz
15	PDB:7q5zA	0.341	0.425	7.586E-63	1344	0.183	0.237	7q5zA.pdb.gz
16	PDB:4lnvA	0.272	0.342	3.843E-62	1276	0.175	0.239	4lnvA.pdb.gz
17	PDB:4lnvB	0.210	0.313	1.327E-46	1063	0.155	0.255	4lnvB.pdb.gz
18	PDB:5a42A	0.232	0.250	3.088E-44	1597	0.131	0.143	5a42A.pdb.gz
19	PDB:4ziqA	0.280	0.327	1.324E-43	1450	0.128	0.154	4ziqA.pdb.gz
20	PDB:4rtdA	0.247	0.367	2.428E-36	1122	0.109	0.169	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SBS4	0.0	631	1642	0.287	0.305	F1SBS4_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=4
2	P01024	0.0	659	1663	0.291	0.305	CO3_HUMAN Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2
3	P01025	0.0	650	1661	0.288	0.302	CO3_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=2
4	P01026	0.0	636	1663	0.284	0.298	CO3_RAT Complement C3 OS=Rattus norvegicus OX=10116 GN=C3 PE=1 SV=3
5	P01027	0.0	651	1663	0.288	0.302	CO3_MOUSE Complement C3 OS=Mus musculus OX=10090 GN=C3 PE=1 SV=3
6	P01029	0.0	2716	1738	0.765	0.768	CO4B_MOUSE Complement C4-B OS=Mus musculus OX=10090 GN=C4b PE=1 SV=3
7	P08649	0.0	2856	1737	0.797	0.800	CO4_RAT Complement C4 OS=Rattus norvegicus OX=10116 GN=C4 PE=1 SV=3
8	P0C0L4	0.0	3608	1744	1.000	1.000	CO4A_HUMAN Complement C4-A OS=Homo sapiens OX=9606 GN=C4A PE=1 SV=2
9	P0C0L5	0.0	3584	1744	0.994	0.994	CO4B_HUMAN Complement C4-B OS=Homo sapiens OX=9606 GN=C4B PE=1 SV=2
10	P98093	0.0	655	1640	0.287	0.305	CO3_ONCMY Complement C3 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=c3 PE=1 SV=1
11	Q076D6	0.0	1038	1665	0.369	0.386	Q076D6_CHICK MHC-linked complement C4 OS=Gallus gallus OX=9031 GN=C4-2 PE=2 SV=1
12	Q3MU74	0.0	653	1651	0.296	0.313	Q3MU74_DANRE Complement component C3-1 OS=Danio rerio OX=7955 GN=C3-1 PE=1 SV=1
13	Q6MG90	0.0	2835	1737	0.792	0.796	Q6MG90_RAT Complement C4B (Chido blood group) OS=Rattus norvegicus OX=10116 GN=C4b PE=4 SV=1
14	Q90633	0.0	681	1652	0.294	0.311	Q90633_CHICK Complement C3 OS=Gallus gallus OX=9031 PE=2 SV=1
15	Q91132	0.0	636	1642	0.276	0.293	VCO3_NAJKA Cobra venom factor OS=Naja kaouthia OX=8649 PE=1 SV=1
16	Q98977	0.0	602	1614	0.272	0.294	Q98977_ONCMY Complement component C3-3 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
17	P06684	3.18e-131	452	1680	0.210	0.218	CO5_MOUSE Complement C5 OS=Mus musculus OX=10090 GN=C5 PE=1 SV=2
18	P08650	5.37e-128	443	1681	0.205	0.212	CO5_RAT Complement C5 OS=Rattus norvegicus OX=10116 GN=C5 PE=1 SV=3
19	P01031	3.06e-126	438	1676	0.206	0.214	CO5_HUMAN Complement C5 OS=Homo sapiens OX=9606 GN=C5 PE=1 SV=4
20	Q9DDV9	5.06e-120	419	1684	0.199	0.206	Q9DDV9_ONCMY Complement component C3-4 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	1.4e-23	93.8	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	1.7e-20	85.2	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	2.4e-24	97.1	A-macroglobulin receptor binding domain
4	PF01821 ANATO	6.6e-06	38.2	Anaphylotoxin-like domain
5	PF02369 Big_1	32	16.0	Bacterial Ig-like domain (group 1)
6	PF01835 MG2	5.4e-14	63.7	MG2 domain
7	PF17791 MG3	2.4e-14	64.7	Macroglobulin domain MG3
8	PF17789 MG4	3e-06	38.7	Macroglobulin domain MG4
9	PF01759 NTR	3.2e-17	73.6	UNC-6/NTR/C345C module
10	PF00432 Prenyltrans	1.6e+02	13.4	Prenyltransferase and squalene oxidase repeat
11	PF13243 SQHop_cyclase_C	4.8e+02	11.1	Squalene-hopene cyclase C-terminal domain
12	PF07678 TED_complement	3.3e-103	356.6	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396688

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383690	0.991	Mannan-binding lectin serine protease 2
2	9606.ENSP00000385035	0.991	Complement C1s subcomponent
3	9606.ENSP00000438615	0.986	Complement C1r subcomponent
4	9606.ENSP00000296280	0.976	Mannan binding lectin serine peptidase 1
5	9606.ENSP00000356037	0.972	C4b-binding protein alpha chain
6	9606.ENSP00000363079	0.972	Mannose-binding protein C
7	9606.ENSP00000356016	0.970	Complement receptor type 1
8	9606.ENSP00000313967	0.967	Complement C1q subcomponent subunit B
9	9606.ENSP00000291744	0.965	Ficolin-2
10	9606.ENSP00000415941	0.964	Complement C4-B
11	9606.ENSP00000363770	0.962	Complement C1q subcomponent subunit C
12	9606.ENSP00000270879	0.961	Ficolin-3
13	9606.ENSP00000363773	0.958	Complement C1q subcomponent subunit A
14	9606.ENSP00000360871	0.951	Ficolin-1
15	9606.ENSP00000411770	0.951	Collectin-11
16	9606.ENSP00000299367	0.948	Complement C2
17	9606.ENSP00000313875	0.943	Membrane cofactor protein
18	9606.ENSP00000356030	0.935	Complement decay-accelerating factor
19	9606.ENSP00000223642	0.929	Complement C5
20	9606.ENSP00000332723	0.928	Collectin-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001848	1.000	complement binding
GO:0044877	0.995	protein-containing complex binding
GO:0001846	0.991	opsonin binding
GO:0030246	0.674	carbohydrate binding
GO:0001849	0.532	complement component C1q complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0048518	0.996	positive regulation of biological process
GO:0048583	0.990	regulation of response to stimulus
GO:0006956	0.980	complement activation
GO:0050794	0.967	regulation of cellular process
GO:0032879	0.886	regulation of localization
GO:0051049	0.760	regulation of transport
GO:0060627	0.651	regulation of vesicle-mediated transport
GO:0051050	0.597	positive regulation of transport
GO:0050764	0.541	regulation of phagocytosis
GO:0050766	0.441	positive regulation of phagocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0071944	0.919	cell periphery
GO:0043226	0.917	organelle
GO:0043227	0.914	membrane-bounded organelle
GO:0031982	0.840	vesicle
GO:0070062	0.761	extracellular exosome
GO:0005622	0.696	intracellular anatomical structure
GO:0043229	0.692	intracellular organelle
GO:0016020	0.676	membrane
GO:0043231	0.657	intracellular membrane-bounded organelle
GO:0005737	0.627	cytoplasm
GO:0032991	0.526	protein-containing complex
GO:0005886	0.499	plasma membrane
GO:1902494	0.495	catalytic complex
GO:0072562	0.468	blood microparticle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]