StarFunc result for job id P0C0L5

User Input

>input (1744 residues)
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN
PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDS
LSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVEN
SHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPN
FEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSW
YFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD
IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDS
RPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPS
FYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQW
TLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRA
ARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPE
NWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP
MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
VVPTAATAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEI
PGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAP
TLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRGSSTWLTA
FVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDLSPVIHRSMQGGLVGNDETVA
LTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYAL
TLTKAPADLRGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL
WIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASH
TTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKV
LRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTP
LQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYY
NPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYY
PRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG
KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQ
GCQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B8JKW4	0.621	0.655	0.000	1643	0.279	0.296	B8JKW4.pdb.gz
2	AFDB:P01024	0.440	0.458	0.000	1663	0.274	0.287	P01024.pdb.gz	CO3_HUMAN Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2
3	AFDB:P01025	0.452	0.472	0.000	1661	0.281	0.295	P01025.pdb.gz	CO3_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=2
4	AFDB:P01026	0.446	0.464	0.000	1663	0.279	0.292	P01026.pdb.gz	CO3_RAT Complement C3 OS=Rattus norvegicus OX=10116 GN=C3 PE=1 SV=3
5	AFDB:P01029	0.966	0.970	0.000	1738	0.761	0.764	P01029.pdb.gz	CO4B_MOUSE Complement C4-B OS=Mus musculus OX=10090 GN=C4b PE=1 SV=3
6	AFDB:P08649	0.972	0.976	0.000	1737	0.792	0.796	P08649.pdb.gz	CO4_RAT Complement C4 OS=Rattus norvegicus OX=10116 GN=C4 PE=1 SV=3
7	AFDB:P0C0L4	0.989	0.989	0.000	1744	0.994	0.994	P0C0L4.pdb.gz	CO4A_HUMAN Complement C4-A OS=Homo sapiens OX=9606 GN=C4A PE=1 SV=2
8	AFDB:P98093	0.534	0.565	0.000	1640	0.284	0.302	P98093.pdb.gz	CO3_ONCMY Complement C3 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=c3 PE=1 SV=1
9	AFDB:Q91132	0.543	0.574	0.000	1642	0.272	0.289	Q91132.pdb.gz	VCO3_NAJKA Cobra venom factor OS=Naja kaouthia OX=8649 PE=1 SV=1
10	AFDB:P06684	0.451	0.466	6.782E-101	1680	0.253	0.263	P06684.pdb.gz	CO5_MOUSE Complement C5 OS=Mus musculus OX=10090 GN=C5 PE=1 SV=2
11	PDB:7nycA	0.532	0.592	4.680E-86	1542	0.235	0.266	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
12	PDB:6h03A	0.466	0.648	8.446E-69	1223	0.189	0.269	6h03A.pdb.gz
13	PDB:7q1yA	0.338	0.416	2.000E-68	1374	0.180	0.229	7q1yA.pdb.gz
14	PDB:7vonA	0.350	0.425	2.146E-65	1399	0.197	0.245	7vonA.pdb.gz
15	PDB:7q5zA	0.339	0.423	1.056E-62	1344	0.179	0.232	7q5zA.pdb.gz
16	PDB:4lnvA	0.274	0.346	2.389E-61	1276	0.178	0.243	4lnvA.pdb.gz
17	PDB:4lnvB	0.202	0.303	4.171E-46	1063	0.159	0.262	4lnvB.pdb.gz
18	PDB:5a42A	0.245	0.264	2.227E-43	1597	0.123	0.135	5a42A.pdb.gz
19	PDB:4ziqA	0.298	0.346	3.345E-42	1450	0.118	0.142	4ziqA.pdb.gz
20	PDB:4rtdA	0.249	0.370	1.074E-35	1122	0.106	0.165	4rtdA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SBS4	0.0	638	1642	0.288	0.306	F1SBS4_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=4
2	P01024	0.0	667	1663	0.292	0.306	CO3_HUMAN Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2
3	P01025	0.0	656	1661	0.289	0.303	CO3_PIG Complement C3 OS=Sus scrofa OX=9823 GN=C3 PE=1 SV=2
4	P01026	0.0	641	1663	0.285	0.299	CO3_RAT Complement C3 OS=Rattus norvegicus OX=10116 GN=C3 PE=1 SV=3
5	P01027	0.0	655	1663	0.290	0.304	CO3_MOUSE Complement C3 OS=Mus musculus OX=10090 GN=C3 PE=1 SV=3
6	P01029	0.0	2712	1738	0.764	0.767	CO4B_MOUSE Complement C4-B OS=Mus musculus OX=10090 GN=C4b PE=1 SV=3
7	P08649	0.0	2851	1737	0.796	0.799	CO4_RAT Complement C4 OS=Rattus norvegicus OX=10116 GN=C4 PE=1 SV=3
8	P0C0L4	0.0	3584	1744	0.994	0.994	CO4A_HUMAN Complement C4-A OS=Homo sapiens OX=9606 GN=C4A PE=1 SV=2
9	P0C0L5	0.0	3605	1744	1.000	1.000	CO4B_HUMAN Complement C4-B OS=Homo sapiens OX=9606 GN=C4B PE=1 SV=2
10	P98093	0.0	664	1640	0.288	0.307	CO3_ONCMY Complement C3 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=c3 PE=1 SV=1
11	Q076D6	0.0	1043	1665	0.370	0.387	Q076D6_CHICK MHC-linked complement C4 OS=Gallus gallus OX=9031 GN=C4-2 PE=2 SV=1
12	Q3MU74	0.0	656	1651	0.295	0.312	Q3MU74_DANRE Complement component C3-1 OS=Danio rerio OX=7955 GN=C3-1 PE=1 SV=1
13	Q6MG90	0.0	2828	1737	0.791	0.794	Q6MG90_RAT Complement C4B (Chido blood group) OS=Rattus norvegicus OX=10116 GN=C4b PE=4 SV=1
14	Q90633	0.0	687	1652	0.296	0.312	Q90633_CHICK Complement C3 OS=Gallus gallus OX=9031 PE=2 SV=1
15	Q91132	0.0	635	1642	0.275	0.292	VCO3_NAJKA Cobra venom factor OS=Naja kaouthia OX=8649 PE=1 SV=1
16	Q98977	0.0	606	1614	0.272	0.294	Q98977_ONCMY Complement component C3-3 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=2
17	P06684	1.14e-130	451	1680	0.210	0.218	CO5_MOUSE Complement C5 OS=Mus musculus OX=10090 GN=C5 PE=1 SV=2
18	P08650	4.53e-128	443	1681	0.205	0.213	CO5_RAT Complement C5 OS=Rattus norvegicus OX=10116 GN=C5 PE=1 SV=3
19	P01031	4.33e-127	440	1676	0.208	0.216	CO5_HUMAN Complement C5 OS=Homo sapiens OX=9606 GN=C5 PE=1 SV=4
20	Q9DDV9	7.28e-120	419	1684	0.198	0.205	Q9DDV9_ONCMY Complement component C3-4 (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00207 A2M	1.4e-23	93.8	Alpha-2-macroglobulin family
2	PF07703 A2M_BRD	1.7e-20	85.2	Alpha-2-macroglobulin bait region domain
3	PF07677 A2M_recep	2.4e-24	97.1	A-macroglobulin receptor binding domain
4	PF01821 ANATO	6.6e-06	38.2	Anaphylotoxin-like domain
5	PF02369 Big_1	31	16.0	Bacterial Ig-like domain (group 1)
6	PF01835 MG2	5.8e-14	63.6	MG2 domain
7	PF17791 MG3	2.4e-14	64.7	Macroglobulin domain MG3
8	PF17789 MG4	3e-06	38.7	Macroglobulin domain MG4
9	PF01759 NTR	3.2e-17	73.6	UNC-6/NTR/C345C module
10	PF00432 Prenyltrans	8e+02	11.2	Prenyltransferase and squalene oxidase repeat
11	PF07678 TED_complement	3.3e-103	356.6	A-macroglobulin TED domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415941

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385035	0.993	Complement C1s subcomponent
2	9606.ENSP00000296280	0.991	Mannan binding lectin serine peptidase 1
3	9606.ENSP00000438615	0.988	Complement C1r subcomponent
4	9606.ENSP00000383690	0.985	Mannan-binding lectin serine protease 2
5	9606.ENSP00000356016	0.978	Complement receptor type 1
6	9606.ENSP00000377783	0.978	Vitamin K-dependent protein S
7	9606.ENSP00000363079	0.973	Mannose-binding protein C
8	9606.ENSP00000313875	0.970	Membrane cofactor protein
9	9606.ENSP00000361359	0.970	Tumor necrosis factor receptor superfamily member 5
10	9606.ENSP00000291744	0.967	Ficolin-2
11	9606.ENSP00000313967	0.967	Complement C1q subcomponent subunit B
12	9606.ENSP00000299367	0.966	Complement C2
13	9606.ENSP00000396688	0.964	Complement C4-A
14	9606.ENSP00000363770	0.962	Complement C1q subcomponent subunit C
15	9606.ENSP00000270879	0.961	Ficolin-3
16	9606.ENSP00000363773	0.959	Complement C1q subcomponent subunit A
17	9606.ENSP00000356037	0.955	C4b-binding protein alpha chain
18	9606.ENSP00000411770	0.952	Collectin-11
19	9606.ENSP00000360871	0.951	Ficolin-1
20	9606.ENSP00000243611	0.943	C4b-binding protein beta chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001848	1.000	complement binding
GO:0044877	0.995	protein-containing complex binding
GO:0001846	0.975	opsonin binding
GO:0030246	0.660	carbohydrate binding
GO:0098772	0.643	molecular function regulator activity
GO:0005102	0.547	signaling receptor binding
GO:0001849	0.306	complement component C1q complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0048518	0.996	positive regulation of biological process
GO:0048583	0.995	regulation of response to stimulus
GO:0002682	0.986	regulation of immune system process
GO:0050776	0.979	regulation of immune response
GO:0002684	0.978	positive regulation of immune system process
GO:0006956	0.974	complement activation
GO:0050794	0.963	regulation of cellular process
GO:0032879	0.935	regulation of localization
GO:0051049	0.758	regulation of transport
GO:0060627	0.652	regulation of vesicle-mediated transport
GO:0051050	0.609	positive regulation of transport
GO:0050764	0.552	regulation of phagocytosis
GO:0050766	0.431	positive regulation of phagocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0071944	0.927	cell periphery
GO:0043227	0.919	membrane-bounded organelle
GO:0031982	0.874	vesicle
GO:0070062	0.772	extracellular exosome
GO:0005622	0.695	intracellular anatomical structure
GO:0043229	0.690	intracellular organelle
GO:0016020	0.673	membrane
GO:0043231	0.664	intracellular membrane-bounded organelle
GO:0005737	0.634	cytoplasm
GO:0005886	0.504	plasma membrane
GO:0032991	0.495	protein-containing complex
GO:0072562	0.479	blood microparticle
GO:1902494	0.448	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]