StarFunc result for job id P0C0S5

User Input

>input (128 residues)
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7ZU59	0.916	0.789	8.043E-20	149	0.992	0.852	Q7ZU59.pdb.gz
2	AFDB:P08985	0.861	0.786	4.897E-19	141	0.938	0.851	P08985.pdb.gz	H2AV_DROME Histone H2A.v OS=Drosophila melanogaster OX=7227 GN=His2Av PE=1 SV=2
3	AFDB:Q9C944	0.874	0.835	1.709E-17	134	0.758	0.724	Q9C944.pdb.gz	H2AV3_ARATH Probable histone H2A variant 3 OS=Arabidopsis thaliana OX=3702 GN=At1g52740 PE=1 SV=1
4	AFDB:Q27511	0.897	0.821	2.047E-17	140	0.859	0.786	Q27511.pdb.gz	H2AV_CAEEL Histone H2A.V OS=Caenorhabditis elegans OX=6239 GN=htz-1 PE=1 SV=3
5	AFDB:O23628	0.863	0.813	7.250E-17	136	0.773	0.728	O23628.pdb.gz	H2AV1_ARATH Histone H2A variant 1 OS=Arabidopsis thaliana OX=3702 GN=H2AV PE=1 SV=1
6	AFDB:O97320	0.855	0.696	1.406E-16	158	0.766	0.620	O97320.pdb.gz	O97320_PLAF7 Histone H2A OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0320900 PE=3 SV=1
7	PDB:5z30G	0.846	0.983	6.726E-16	110	0.852	0.991	5z30G.pdb.gz	Cancer-associated mutations of histones H2B, H3.1 and H2A.Z.1 affect the structure and stability of the nucleosome.
8	AFDB:Q12692	0.883	0.846	9.092E-16	134	0.672	0.642	Q12692.pdb.gz	H2AZ_YEAST Histone H2A.Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HTZ1 PE=1 SV=3
9	AFDB:P48003	0.785	0.725	2.531E-15	139	0.688	0.633	P48003.pdb.gz	H2AZ_SCHPO Histone H2A.Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pht1 PE=1 SV=3
10	AFDB:Q582M3	0.852	0.619	1.124E-13	179	0.539	0.385	Q582M3.pdb.gz	Q582M3_TRYB2 Histone H2A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.33N13.260 PE=3 SV=1
11	AFDB:Q8CGP4	0.820	0.814	1.346E-13	129	0.594	0.589	Q8CGP4.pdb.gz	Q8CGP4_MOUSE Histone H2A OS=Mus musculus OX=10090 GN=H2ac1 PE=1 SV=1
12	PDB:1id3C	0.790	0.913	4.846E-10	110	0.492	0.573	1id3C.pdb.gz	Structure of the yeast nucleosome core particle reveals fundamental changes in internucleosome interactions.
13	PDB:2rvqC	0.519	0.501	1.432E-9	133	0.586	0.564	2rvqC.pdb.gz
14	PDB:7pj1A	0.455	0.471	3.044E-7	123	0.578	0.602	7pj1A.pdb.gz
15	PDB:6m4gC	0.625	0.862	3.995E-5	90	0.281	0.400	6m4gC.pdb.gz	Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
16	PDB:5y26B	0.455	0.602	1.394E-3	92	0.156	0.217	5y26B.pdb.gz
17	PDB:6a7uA	0.591	0.448	6.673E-3	170	0.258	0.194	6a7uA.pdb.gz
18	PDB:7pj1B	0.465	0.483	9.017E-3	122	0.195	0.205	7pj1B.pdb.gz
19	PDB:1bfmA	0.446	0.755	1.080E-2	69	0.133	0.246	1bfmA.pdb.gz
20	PDB:2rvqD	0.420	0.417	1.294E-2	129	0.156	0.155	2rvqD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C0S5	1.08e-87	252	128	1.000	1.000	H2AZ_HUMAN Histone H2A.Z OS=Homo sapiens OX=9606 GN=H2AZ1 PE=1 SV=2
2	P0C0S6	1.08e-87	252	128	1.000	1.000	H2AZ_MOUSE Histone H2A.Z OS=Mus musculus OX=10090 GN=H2az1 PE=1 SV=2
3	P0C0S7	1.08e-87	252	128	1.000	1.000	H2AZ_RAT Histone H2A.Z OS=Rattus norvegicus OX=10116 GN=H2az1 PE=1 SV=2
4	Q0Z946	3.80e-87	251	128	0.992	0.992	Q0Z946_DANRE Histone H2A OS=Danio rerio OX=7955 GN=h2afvb PE=2 SV=1
5	Q71UI9	9.69e-86	247	128	0.977	0.977	H2AV_HUMAN Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AZ2 PE=1 SV=3
6	P08985	3.79e-81	236	141	0.938	0.851	H2AV_DROME Histone H2A.v OS=Drosophila melanogaster OX=7227 GN=His2Av PE=1 SV=2
7	Q27511	1.01e-71	212	140	0.859	0.786	H2AV_CAEEL Histone H2A.V OS=Caenorhabditis elegans OX=6239 GN=htz-1 PE=1 SV=3
8	Q9SII0	7.06e-64	192	136	0.742	0.699	H2AV2_ARATH Probable histone H2A variant 2 OS=Arabidopsis thaliana OX=3702 GN=At2g38810 PE=2 SV=1
9	O23628	5.80e-63	190	136	0.773	0.728	H2AV1_ARATH Histone H2A variant 1 OS=Arabidopsis thaliana OX=3702 GN=H2AV PE=1 SV=1
10	Q9C944	7.15e-63	190	134	0.758	0.724	H2AV3_ARATH Probable histone H2A variant 3 OS=Arabidopsis thaliana OX=3702 GN=At1g52740 PE=1 SV=1
11	O97320	6.71e-61	186	158	0.695	0.563	O97320_PLAF7 Histone H2A OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0320900 PE=3 SV=1
12	P48003	4.05e-54	168	139	0.625	0.576	H2AZ_SCHPO Histone H2A.Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pht1 PE=1 SV=3
13	B4UMZ4	5.72e-53	165	133	0.656	0.632	B4UMZ4_CANGA Histone H2A OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0E02315g PE=3 SV=1
14	Q12692	7.28e-50	157	134	0.617	0.590	H2AZ_YEAST Histone H2A.Z OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HTZ1 PE=1 SV=3
15	Q16777	2.65e-44	142	129	0.594	0.589	H2A2C_HUMAN Histone H2A type 2-C OS=Homo sapiens OX=9606 GN=H2AC20 PE=1 SV=4
16	Q6FI13	4.37e-44	142	130	0.594	0.585	H2A2A_HUMAN Histone H2A type 2-A OS=Homo sapiens OX=9606 GN=H2AC18 PE=1 SV=3
17	Q9BTM1	5.63e-44	142	129	0.609	0.605	H2AJ_HUMAN Histone H2A.J OS=Homo sapiens OX=9606 GN=H2AJ PE=1 SV=1
18	Q7L7L0	6.13e-44	142	130	0.594	0.585	H2A3_HUMAN Histone H2A type 3 OS=Homo sapiens OX=9606 GN=H2AC25 PE=1 SV=3
19	P20671	6.41e-44	142	130	0.594	0.585	H2A1D_HUMAN Histone H2A type 1-D OS=Homo sapiens OX=9606 GN=H2AC7 PE=1 SV=2
20	P70082	1.11e-43	141	129	0.586	0.581	H2AJ_CHICK Histone H2A.J OS=Gallus gallus OX=9031 GN=H2A-IX PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00808 CBFD_NFYB_HMF	31	16.2	Histone-like transcription factor (CBF/NF-Y) and archaeal histone
2	PF00125 Histone	2.3e-15	68.4	Core histone H2A/H2B/H3/H4
3	PF16211 Histone_H2A_C	5.8e-10	50.1	C-terminus of histone H2A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008824387.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008824872.1	0.984	Uncharacterized protein LOC103728687
2	1026970.XP_008826465.1	0.979	Vacuolar protein sorting-associated protein 72 homolog
3	1026970.XP_008826779.1	0.967	RuvB like AAA ATPase 1
4	1026970.XP_008841938.1	0.965	Histone H2B type 2-E
5	1026970.XP_008841933.1	0.959	Histone H2B type 1-H-like
6	1026970.XP_008843243.1	0.957	ruvB-like 2
7	1026970.XP_008830107.1	0.955	Histone H2B type 1-B
8	1026970.XP_008849371.1	0.953	Actin-related protein 6
9	1026970.XP_008825243.1	0.950	Histone H2B type 3-B
10	1026970.XP_008830084.1	0.950	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
11	1026970.XP_008841936.1	0.950	Histone H3-like
12	1026970.XP_008825242.1	0.948	Histone H2B type 3-A
13	1026970.XP_008830079.1	0.948	Uncharacterized protein LOC103733091
14	1026970.XP_008820423.1	0.944	Histone acetyltransferase KAT5 isoform X1
15	1026970.XP_008821918.1	0.944	YEATS domain-containing protein 4
16	1026970.XP_008824873.1	0.941	Histone H2B type 1-like
17	1026970.XP_008830093.1	0.941	Histone H2B type 1-N-like
18	1026970.XP_008843627.1	0.941	DNA methyltransferase 1-associated protein 1
19	1026970.XP_008821182.1	0.938	Craniofacial development protein 1
20	1026970.XP_008830530.1	0.937	Zinc finger HIT domain-containing protein 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.925	organic cyclic compound binding
GO:0003676	0.922	nucleic acid binding
GO:0003677	0.876	DNA binding
GO:0043565	0.472	sequence-specific DNA binding
GO:0003682	0.369	chromatin binding
GO:0003690	0.363	double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.981	regulation of biological process
GO:0019222	0.964	regulation of metabolic process
GO:0008152	0.952	metabolic process
GO:0050794	0.908	regulation of cellular process
GO:0071704	0.892	organic substance metabolic process
GO:0044238	0.886	primary metabolic process
GO:0006807	0.854	nitrogen compound metabolic process
GO:0050896	0.845	response to stimulus
GO:0044237	0.837	cellular metabolic process
GO:0043170	0.819	macromolecule metabolic process
GO:0060255	0.792	regulation of macromolecule metabolic process
GO:0080090	0.761	regulation of primary metabolic process
GO:0051171	0.761	regulation of nitrogen compound metabolic process
GO:0031323	0.756	regulation of cellular metabolic process
GO:0019219	0.690	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.594	regulation of gene expression
GO:0032502	0.588	developmental process
GO:1901360	0.563	organic cyclic compound metabolic process
GO:0034641	0.563	cellular nitrogen compound metabolic process
GO:0046483	0.559	heterocycle metabolic process
GO:0006725	0.556	cellular aromatic compound metabolic process
GO:0006139	0.554	nucleobase-containing compound metabolic process
GO:0032259	0.544	methylation
GO:0048518	0.540	positive regulation of biological process
GO:0009889	0.478	regulation of biosynthetic process
GO:0090304	0.472	nucleic acid metabolic process
GO:0032501	0.465	multicellular organismal process
GO:0031326	0.465	regulation of cellular biosynthetic process
GO:0044260	0.460	cellular macromolecule metabolic process
GO:0010556	0.460	regulation of macromolecule biosynthetic process
GO:0051252	0.459	regulation of RNA metabolic process
GO:0048519	0.456	negative regulation of biological process
GO:0043412	0.456	macromolecule modification
GO:0048856	0.444	anatomical structure development
GO:0006355	0.441	regulation of DNA-templated transcription
GO:0006259	0.425	DNA metabolic process
GO:0048523	0.418	negative regulation of cellular process
GO:0051716	0.417	cellular response to stimulus
GO:0048522	0.389	positive regulation of cellular process
GO:0010605	0.385	negative regulation of macromolecule metabolic process
GO:0007275	0.367	multicellular organism development
GO:0009893	0.347	positive regulation of metabolic process
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0031325	0.313	positive regulation of cellular metabolic process
GO:0051173	0.311	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.966	nuclear lumen
GO:0043232	0.958	intracellular non-membrane-bounded organelle
GO:0032991	0.850	protein-containing complex
GO:0005654	0.831	nucleoplasm
GO:0005694	0.818	chromosome
GO:0000785	0.791	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]