StarFunc result for job id P0C1Z6

User Input

>input (253 residues)
MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSGGLGGSGLRER
DEEEEAARGRRRRQRELNRRKYQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFL
MRVLDSYGDDYRASQFTIVLEDEGSQGTDAPTPGNAENEPPEKETLSPPRRTPAPPEPGS
PAPGEGPSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEADEALDSSWVSRGPDK
LLPYPTLASPASD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3U1J1	0.683	0.671	5.135E-29	259	0.909	0.888	Q3U1J1.pdb.gz	TFPT_MOUSE TCF3 fusion partner homolog OS=Mus musculus OX=10090 GN=Tfpt PE=1 SV=1
2	AFDB:A0A024RAZ1	0.285	0.107	8.316E-1	691	0.142	0.052	A0A024RAZ1.pdb.gz
3	AFDB:E2E3G0	0.104	0.076	9.538E-1	350	0.182	0.131	E2E3G0.pdb.gz
4	AFDB:M9MM95	0.212	0.115	1.172	539	0.158	0.074	M9MM95.pdb.gz
5	AFDB:A0A097PIG6	0.243	0.095	1.344	694	0.146	0.053	A0A097PIG6.pdb.gz	A0A097PIG6_RAT Mitogen-activated protein kinase kinase kinase kinase 4 (Fragment) OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=2 SV=1
6	AFDB:F4HRI2	0.283	0.237	1.542	304	0.126	0.105	F4HRI2.pdb.gz	HEI10_ARATH E3 ubiquitin-protein ligase CCNB1IP1 homolog OS=Arabidopsis thaliana OX=3702 GN=HEI10 PE=2 SV=1
7	AFDB:Q38AX2	0.076	0.052	1.651	403	0.091	0.057	Q38AX2.pdb.gz	Q38AX2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0490 PE=4 SV=1
8	AFDB:Q96K80	0.143	0.091	1.651	434	0.206	0.120	Q96K80.pdb.gz	ZC3HA_HUMAN Zinc finger CCCH domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZC3H10 PE=1 SV=1
9	AFDB:E1ABP3	0.276	0.172	1.768	420	0.130	0.079	E1ABP3.pdb.gz	E1ABP3_ASPFM AfuFlbB beta OS=Aspergillus fumigatus OX=746128 GN=AfuflbB PE=4 SV=1
10	AFDB:Q1RLR5	0.108	0.036	1.768	829	0.158	0.048	Q1RLR5.pdb.gz	Q1RLR5_DANRE B-cell CLL/lymphoma 11A OS=Danio rerio OX=7955 GN=bcl11a PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C1Z6	0.0	498	253	1.000	1.000	TFPT_HUMAN TCF3 fusion partner OS=Homo sapiens OX=9606 GN=TFPT PE=1 SV=1
2	Q3U1J1	1.61e-136	386	259	0.909	0.888	TFPT_MOUSE TCF3 fusion partner homolog OS=Mus musculus OX=10090 GN=Tfpt PE=1 SV=1
3	Q9JMG6	1.46e-131	374	259	0.909	0.888	TFPT_RAT TCF3 fusion partner homolog OS=Rattus norvegicus OX=10116 GN=Tfpt PE=1 SV=2
4	A0A0G2JV76	0.042	37.4	1015	0.095	0.024	A0A0G2JV76_RAT DNA ligase OS=Rattus norvegicus OX=10116 GN=Lig3 PE=1 SV=1
5	F7FP17	0.051	37.4	956	0.095	0.025	F7FP17_RAT DNA ligase OS=Rattus norvegicus OX=10116 GN=Lig3 PE=1 SV=1
6	K4DIA1	0.41	34.7	1962	0.103	0.013	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
7	A0A0A0MT39	0.42	34.7	1962	0.103	0.013	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
8	H9KVD2	0.50	34.3	2016	0.103	0.013	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
9	Q14524	0.51	34.3	2016	0.103	0.013	SCN5A_HUMAN Sodium channel protein type 5 subunit alpha OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=2
10	E9PG18	0.53	34.3	1998	0.103	0.013	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
11	Q5ZLW6	0.54	33.9	902	0.071	0.020	Q5ZLW6_CHICK DNA ligase OS=Gallus gallus OX=9031 GN=RCJMB04_4j11 PE=2 SV=1
12	E9PHB6	0.56	33.9	1983	0.103	0.013	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
13	P35638	0.60	32.7	169	0.087	0.130	DDIT3_HUMAN DNA damage-inducible transcript 3 protein OS=Homo sapiens OX=9606 GN=DDIT3 PE=1 SV=1
14	Q5SUF7	0.94	33.5	2381	0.107	0.011	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
15	E9PWL1	0.95	33.5	2272	0.107	0.012	E9PWL1_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
16	Q5SUG2	0.95	33.5	2176	0.107	0.012	Q5SUG2_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
17	Q6ZPX4	0.95	33.5	1389	0.107	0.019	Q6ZPX4_MOUSE MKIAA1123 protein (Fragment) OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
18	Q5SUF8	0.96	33.5	2254	0.107	0.012	Q5SUF8_MOUSE Calcium channel, voltage-dependent, T type, alpha 1G subunit OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
19	Q3UQG9	0.98	33.1	853	0.107	0.032	Q3UQG9_MOUSE Ion transport domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Cacna1g PE=2 SV=1
20	Q5SUF6	0.98	33.5	2288	0.107	0.012	Q5SUF6_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375639

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000457016	0.987	INO80 complex subunit E
2	9606.ENSP00000356425	0.977	Ubiquitin carboxyl-terminal hydrolase isozyme L5
3	9606.ENSP00000473172	0.970	RuvB-like 2
4	9606.ENSP00000243903	0.967	Actin-related protein 5
5	9606.ENSP00000262238	0.965	Transcriptional repressor protein YY1
6	9606.ENSP00000318297	0.956	RuvB-like 1
7	9606.ENSP00000436926	0.953	Nuclear factor related to kappa-B-binding protein
8	9606.ENSP00000336842	0.950	Actin-related protein 8
9	9606.ENSP00000233331	0.949	INO80 complex subunit B
10	9606.ENSP00000391457	0.947	Chromosome 18 open reading frame 37, isoform CRA_a
11	9606.ENSP00000397552	0.947	Actin-like protein 6A
12	9606.ENSP00000349640	0.946	Microspherule protein 1
13	9606.ENSP00000355205	0.946	DNA helicase INO80
14	9606.ENSP00000467041	0.927	Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair
15	9606.ENSP00000340330	0.904	Histone acetyltransferase KAT5
16	9606.ENSP00000376167	0.904	COP9 signalosome complex subunit 1
17	9606.ENSP00000320566	0.902	Inhibitor of growth protein 3
18	9606.ENSP00000216225	0.900	E3 ubiquitin-protein ligase RBX1
19	9606.ENSP00000254900	0.900	Bromodomain-containing protein 8
20	9606.ENSP00000256996	0.900	DNA damage-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0051052	0.984	regulation of DNA metabolic process
GO:0033043	0.977	regulation of organelle organization
GO:0031325	0.976	positive regulation of cellular metabolic process
GO:0051173	0.974	positive regulation of nitrogen compound metabolic process
GO:0045935	0.964	positive regulation of nucleobase-containing compound metabolic process
GO:0071840	0.958	cellular component organization or biogenesis
GO:0033044	0.957	regulation of chromosome organization
GO:0010604	0.936	positive regulation of macromolecule metabolic process
GO:0071704	0.917	organic substance metabolic process
GO:0044238	0.915	primary metabolic process
GO:0016043	0.893	cellular component organization
GO:0006807	0.888	nitrogen compound metabolic process
GO:0043170	0.872	macromolecule metabolic process
GO:0051726	0.830	regulation of cell cycle
GO:0008219	0.808	cell death
GO:0050896	0.785	response to stimulus
GO:0051716	0.726	cellular response to stimulus
GO:0044237	0.691	cellular metabolic process
GO:0009889	0.554	regulation of biosynthetic process
GO:0010468	0.547	regulation of gene expression
GO:0051252	0.545	regulation of RNA metabolic process
GO:0006355	0.541	regulation of DNA-templated transcription
GO:0010557	0.501	positive regulation of macromolecule biosynthetic process
GO:0031328	0.501	positive regulation of cellular biosynthetic process
GO:0051254	0.471	positive regulation of RNA metabolic process
GO:0006325	0.469	chromatin organization
GO:1903508	0.461	positive regulation of nucleic acid-templated transcription
GO:0048583	0.453	regulation of response to stimulus
GO:0034641	0.448	cellular nitrogen compound metabolic process
GO:0045893	0.445	positive regulation of DNA-templated transcription
GO:0006275	0.410	regulation of DNA replication
GO:0006338	0.330	chromatin remodeling
GO:0044260	0.327	cellular macromolecule metabolic process
GO:0090304	0.327	nucleic acid metabolic process
GO:0012501	0.320	programmed cell death
GO:0006915	0.312	apoptotic process
GO:2001020	0.309	regulation of response to DNA damage stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.985	protein-containing complex
GO:0043232	0.945	intracellular non-membrane-bounded organelle
GO:0140513	0.943	nuclear protein-containing complex
GO:1902494	0.918	catalytic complex
GO:0070603	0.895	SWI/SNF superfamily-type complex
GO:0000228	0.888	nuclear chromosome
GO:0097346	0.882	INO80-type complex
GO:0005737	0.704	cytoplasm
GO:0031011	0.607	Ino80 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]