StarFunc result for job id P0C5K6

User Input

>input (33 residues)
MSPPSSMCSPVPLLAAASGQNRMTQGQHFLQKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q94B60	0.504	0.067	3.140	292	0.364	0.041	Q94B60.pdb.gz	CLPP4_ARATH ATP-dependent Clp protease proteolytic subunit 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPP4 PE=1 SV=1
2	AFDB:Q8LG88	0.384	0.038	5.984	540	0.212	0.013	Q8LG88.pdb.gz	TDT_ARATH Tonoplast dicarboxylate transporter OS=Arabidopsis thaliana OX=3702 GN=TDT PE=2 SV=2
3	AFDB:O22164	0.319	0.080	6.486	248	0.242	0.032	O22164.pdb.gz	O22164_ARATH Expressed protein OS=Arabidopsis thaliana OX=3702 GN=At2g44870 PE=1 SV=2
4	AFDB:Q9LRB7	0.399	0.067	8.954	325	0.394	0.040	Q9LRB7.pdb.gz	EL5_ORYSJ E3 ubiquitin-protein ligase EL5 OS=Oryza sativa subsp. japonica OX=39947 GN=EL5.1 PE=1 SV=1
5	AFDB:P13423	0.352	0.029	9.706	764	0.152	0.007	P13423.pdb.gz	PAG_BACAN Protective antigen OS=Bacillus anthracis OX=1392 GN=pagA PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8MQQ8	7.2	24.6	1332	0.394	0.010	Q8MQQ8_DROME LD21041p (Fragment) OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=2 SV=1
2	Q9VLS7	9.5	24.3	2016	0.394	0.006	Q9VLS7_DROME LD21067p OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
3	X2JDJ3	9.6	24.3	2015	0.394	0.006	X2JDJ3_DROME Phosphatidic acid phospholipase A1, isoform D OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 289377.HL41_08385

Rank	PPI partner	STRING score	Description
1	289377.HL41_00455	0.999	Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nascent chain (RNC) as it emerges from the ribosomes. The SRP-RNC complex is then targeted to the cytoplasmic membrane where it interacts with the SRP receptor FtsY.
2	289377.HL41_02845	0.966	Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. SecDF uses the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA
3	289377.HL41_05345	0.966	The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug. The plug probably moves laterally to allow the channel to open. The ring and the pore may move independently.
4	289377.HL41_01720	0.939	Uncharacterized protein
5	289377.HL41_04075	0.936	Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Aids folding of multispanning membrane proteins
6	289377.HL41_05700	0.888	Uncharacterized protein
7	289377.HL41_05435	0.821	One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome
8	289377.HL41_06730	0.786	ATPase that binds to both the 70S ribosome and the 50S ribosomal subunit in a nucleotide-independent manner.
9	289377.HL41_03035	0.777	Belongs to the peptidase S26 family.
10	289377.HL41_09000	0.758	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
11	289377.HL41_01845	0.755	This protein specifically catalyzes the removal of signal peptides from prolipoproteins
12	289377.HL41_02350	0.755	Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some mRNAs, and tRNAs when they are encoded in the rRNA operon. Processes pre-crRNA and tracrRNA of type II CRISPR loci if present in the organism
13	289377.HL41_05740	0.738	Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a critical role in biogenesis of 30S subunits
14	289377.HL41_05430	0.733	One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity
15	289377.HL41_01160	0.730	Acts as a chaperone
16	289377.HL41_03040	0.725	Required for accurate and efficient protein synthesis under certain stress conditions. May act as a fidelity factor of the translation reaction, by catalyzing a one-codon backward translocation of tRNAs on improperly translocated ribosomes. Back-translocation proceeds from a post-translocation (POST) complex to a pre- translocation (PRE) complex, thus giving elongation factor G a second chance to translocate the tRNAs correctly. Binds to ribosomes in a GTP- dependent manner
17	289377.HL41_04770	0.713	Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.
18	289377.HL41_04630	0.711	Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter
19	289377.HL41_05290	0.711	Involved in protein export. Acts as a chaperone by maintaining the newly synthesized protein in an open conformation. Functions as a peptidyl-prolyl cis-trans isomerase
20	289377.HL41_01155	0.710	Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	1.000	catalytic activity
GO:0003674	1.000	molecular_function
GO:0016740	0.623	transferase activity
GO:0140096	0.450	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.594	cellular process
GO:0048856	0.417	anatomical structure development
GO:0007275	0.408	multicellular organism development
GO:0050896	0.370	response to stimulus
GO:0048869	0.342	cellular developmental process
GO:0048731	0.342	system development
GO:0050789	0.324	regulation of biological process
GO:0050794	0.304	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0043233	0.645	organelle lumen
GO:0070013	0.638	intracellular organelle lumen
GO:0005739	0.541	mitochondrion
GO:0005634	0.519	nucleus
GO:0031981	0.378	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.623	Transferases.

[back to server]