StarFunc result for job id P0C6A0

User Input

>input (271 residues)
MTEPQVGCVACPRVHKEPAQVGTPWPAKPRSHPRKRDPTALLPRSLWPACQESVTALCFL
QETVERLGQSPAQDTPVLGPCWDPMALGTQGRLLLDRDSKDTQTRISQKGRRLQPPGTPS
APPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQESPADA
VGGPAAHPGGTEAHSAGSEALEPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTR
CSSCWLVPRKNVQPKRLCGRCGVSLDPIQEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97489	0.146	0.101	9.027E-4	404	0.177	0.119	P97489.pdb.gz	GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus OX=10090 GN=Gata5 PE=1 SV=2
2	AFDB:A0A2R9YJP8	0.147	0.093	2.461E-3	460	0.221	0.130	A0A2R9YJP8.pdb.gz
3	AFDB:P17429	0.154	0.050	5.222E-3	876	0.203	0.063	P17429.pdb.gz	AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=areA PE=1 SV=2
4	AFDB:Q3S1J8	0.138	0.079	5.222E-3	488	0.151	0.084	Q3S1J8.pdb.gz	Q3S1J8_CAEEL GATA-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elt-1 PE=4 SV=1
5	AFDB:Q91428	0.155	0.100	7.607E-3	438	0.185	0.114	Q91428.pdb.gz	GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio OX=7955 GN=gata3 PE=2 SV=1
6	AFDB:Q6FWW9	0.143	0.050	1.337E-2	823	0.185	0.061	Q6FWW9.pdb.gz	Q6FWW9_CANGA Candida glabrata strain CBS138 chromosome C complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GLN3 PE=4 SV=1
7	AFDB:Q9XUW7	0.139	0.155	1.127E-1	242	0.144	0.161	Q9XUW7.pdb.gz	Q9XUW7_CAEEL GATA-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=end-3 PE=4 SV=1
8	PDB:5dkaA	0.125	0.302	5.224E-1	96	0.052	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
9	AFDB:Q55C49	0.124	0.039	7.868E-1	1006	0.137	0.037	Q55C49.pdb.gz	GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum OX=44689 GN=gtaG PE=4 SV=1
10	AFDB:A2APF3	0.098	0.060	1.299	636	0.140	0.060	A2APF3.pdb.gz	CTCFL_MOUSE Transcriptional repressor CTCFL OS=Mus musculus OX=10090 GN=Ctcfl PE=1 SV=1
11	AFDB:A0A1D5PRD7	0.123	0.050	1.383	772	0.118	0.041	A0A1D5PRD7.pdb.gz	A0A1D5PRD7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C1 PE=1 SV=1
12	PDB:7ok0H	0.074	0.237	1.517	78	0.007	0.026	7ok0H.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
13	PDB:5gm6a	0.130	0.252	1.830	123	0.041	0.089	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7oniR	0.141	0.354	1.949	86	0.066	0.209	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
15	PDB:4a0cF	0.118	0.330	2.209	80	0.037	0.125	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
16	PDB:5mlkB	0.076	0.055	2.209	384	0.011	0.008	5mlkB.pdb.gz
17	PDB:3aqqA	0.077	0.178	2.352	99	0.018	0.051	3aqqA.pdb.gz
18	PDB:7l08J	0.066	0.096	2.352	175	0.018	0.029	7l08J.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
19	PDB:7snyA	0.097	0.159	2.504	159	0.018	0.031	7snyA.pdb.gz
20	PDB:6asyA	0.083	0.041	3.022	606	0.018	0.008	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1WG82	7.80e-84	253	266	0.528	0.538	ZGLP1_MOUSE GATA-type zinc finger protein 1 OS=Mus musculus OX=10090 GN=Zglp1 PE=2 SV=1
2	Q9ZPX0	1.32e-07	53.1	208	0.122	0.159	GAT20_ARATH GATA transcription factor 20 OS=Arabidopsis thaliana OX=3702 GN=GATA20 PE=2 SV=2
3	Q6L5E5	1.09e-06	51.2	279	0.092	0.090	GAT15_ORYSJ GATA transcription factor 15 OS=Oryza sativa subsp. japonica OX=39947 GN=GATA15 PE=1 SV=1
4	P17429	1.64e-06	51.2	876	0.096	0.030	AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=areA PE=1 SV=2
5	Q4WCP6	2.37e-06	50.8	881	0.092	0.028	Q4WCP6_ASPFU GATA transcriptional activator AreA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G01970 PE=4 SV=1
6	Q10134	2.45e-06	50.8	564	0.070	0.034	FEP1_SCHPO Iron-sensing transcriptional repressor OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fep1 PE=1 SV=1
7	Q8LC79	3.59e-06	49.7	295	0.085	0.078	GAT18_ARATH GATA transcription factor 18 OS=Arabidopsis thaliana OX=3702 GN=GATA18 PE=1 SV=2
8	Q6QPM2	4.02e-06	48.9	211	0.092	0.118	GAT19_ARATH GATA transcription factor 19 OS=Arabidopsis thaliana OX=3702 GN=GATA19 PE=1 SV=2
9	G5EB20	7.43e-06	49.3	549	0.070	0.035	SREA_EMENI GATA-type transcription factor sreA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sreA PE=2 SV=1
10	Q4WV91	9.91e-06	48.9	546	0.070	0.035	SREA_ASPFU GATA-type transcription factor sreA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sreA PE=2 SV=1
11	Q7T3G1	1.65e-05	48.1	456	0.140	0.083	Q7T3G1_DANRE GATA-binding protein 2a OS=Danio rerio OX=7955 GN=gata2 PE=2 SV=1
12	Q9BPQ3	2.81e-05	47.4	704	0.063	0.024	Q9BPQ3_DROME GATA factor e (Fragment) OS=Drosophila melanogaster OX=7227 GN=GATAe PE=2 SV=1
13	A0A0B4JDD2	2.86e-05	47.4	731	0.063	0.023	A0A0B4JDD2_DROME GATAe, isoform B OS=Drosophila melanogaster OX=7227 GN=GATAe PE=4 SV=1
14	Q9VF00	2.90e-05	47.4	746	0.063	0.023	Q9VF00_DROME GATAe, isoform A OS=Drosophila melanogaster OX=7227 GN=GATAe PE=2 SV=2
15	P26343	2.93e-05	46.6	269	0.070	0.071	DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAL80 PE=2 SV=1
16	P52168	3.19e-05	47.4	540	0.066	0.033	PNR_DROME GATA-binding factor A OS=Drosophila melanogaster OX=7227 GN=pnr PE=1 SV=1
17	Q9BPQ2	3.25e-05	47.4	571	0.063	0.030	Q9BPQ2_DROME DGATAe protein OS=Drosophila melanogaster OX=7227 GN=GATAe PE=2 SV=1
18	P18494	3.37e-05	47.4	730	0.066	0.025	GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLN3 PE=1 SV=2
19	Q5A201	3.37e-05	47.4	712	0.070	0.027	GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GZF3 PE=2 SV=2
20	A0A1D8PNX9	3.92e-05	47.0	682	0.081	0.032	A0A1D8PNX9_CANAL Nitrogen-responsive transcriptional regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GLN3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00320 GATA	9.2e-12	55.7	GATA zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384434

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269216	0.818	Transcription factor GATA-6
2	9606.ENSP00000333188	0.565	Forkhead box protein L2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.997	DNA binding
GO:0043565	0.992	sequence-specific DNA binding
GO:0140110	0.965	transcription regulator activity
GO:0003690	0.948	double-stranded DNA binding
GO:0003700	0.931	DNA-binding transcription factor activity
GO:1990837	0.913	sequence-specific double-stranded DNA binding
GO:0000976	0.893	transcription cis-regulatory region binding
GO:0000981	0.656	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0032502	0.993	developmental process
GO:0032501	0.991	multicellular organismal process
GO:0009987	0.991	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0019222	0.986	regulation of metabolic process
GO:0006355	0.977	regulation of DNA-templated transcription
GO:0048856	0.961	anatomical structure development
GO:0006357	0.942	regulation of transcription by RNA polymerase II
GO:0009892	0.908	negative regulation of metabolic process
GO:0048523	0.887	negative regulation of cellular process
GO:0000003	0.829	reproduction
GO:0008152	0.772	metabolic process
GO:0003006	0.718	developmental process involved in reproduction
GO:0030154	0.717	cell differentiation
GO:0051173	0.697	positive regulation of nitrogen compound metabolic process
GO:0010604	0.681	positive regulation of macromolecule metabolic process
GO:0044237	0.672	cellular metabolic process
GO:0048522	0.659	positive regulation of cellular process
GO:0007276	0.646	gamete generation
GO:0010605	0.634	negative regulation of macromolecule metabolic process
GO:0071704	0.626	organic substance metabolic process
GO:0031328	0.512	positive regulation of cellular biosynthetic process
GO:0045935	0.511	positive regulation of nucleobase-containing compound metabolic process
GO:0044238	0.504	primary metabolic process
GO:0045893	0.497	positive regulation of DNA-templated transcription
GO:0006807	0.476	nitrogen compound metabolic process
GO:0045934	0.465	negative regulation of nucleobase-containing compound metabolic process
GO:0043170	0.447	macromolecule metabolic process
GO:0045944	0.336	positive regulation of transcription by RNA polymerase II
GO:0051253	0.330	negative regulation of RNA metabolic process
GO:0045892	0.315	negative regulation of DNA-templated transcription
GO:0048468	0.313	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.941	intracellular organelle lumen
GO:0031981	0.890	nuclear lumen
GO:0005654	0.859	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]