StarFunc result for job id P0C6T2

User Input

>input (37 residues)
MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C6T2	1.000	1.000	7.208E-5	37	1.000	1.000	P0C6T2.pdb.gz	OST4_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 OS=Homo sapiens OX=9606 GN=OST4 PE=1 SV=1
2	AFDB:Q99380	0.855	0.878	9.739E-1	36	0.324	0.333	Q99380.pdb.gz	OST4_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OST4 PE=1 SV=1
3	AFDB:Q96PP4	0.647	0.102	3.100	275	0.270	0.036	Q96PP4.pdb.gz	TSG13_HUMAN Testis-specific gene 13 protein OS=Homo sapiens OX=9606 GN=TSGA13 PE=1 SV=1
4	AFDB:Q499A3	0.517	0.042	3.368	566	0.108	0.007	Q499A3.pdb.gz	KTU_DANRE Protein kintoun OS=Danio rerio OX=7955 GN=dnaaf2 PE=2 SV=1
5	AFDB:Q96AN5	0.664	0.066	6.008	459	0.243	0.020	Q96AN5.pdb.gz	TM143_HUMAN Transmembrane protein 143 OS=Homo sapiens OX=9606 GN=TMEM143 PE=1 SV=1
6	AFDB:Q0E9G3	0.530	0.031	7.089	834	0.135	0.006	Q0E9G3.pdb.gz	KTU_DROME Protein kintoun OS=Drosophila melanogaster OX=7227 GN=Nop17l PE=1 SV=1
7	AFDB:O14225	0.725	0.190	7.700	152	0.135	0.033	O14225.pdb.gz	TOM20_SCHPO Mitochondrial import receptor subunit tom20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tom20 PE=3 SV=1
8	AFDB:B0S4R3	0.441	0.269	8.364	70	0.189	0.100	B0S4R3.pdb.gz	B0S4R3_SALSA FXYD domain-containing ion transport regulator OS=Salmo salar OX=8030 GN=fxyd11a PE=2 SV=1
9	AFDB:P54070	0.418	0.052	9.085	446	0.243	0.020	P54070.pdb.gz	KTR6_YEAST Mannosyltransferase KTR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KTR6 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C6T2	2.49e-20	75.5	37	1.000	1.000	OST4_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 OS=Homo sapiens OX=9606 GN=OST4 PE=1 SV=1
2	Q96VG2	0.003	32.3	32	0.351	0.406	OST4_SCHPO Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase 4 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ost4 PE=3 SV=1
3	Q99380	1.1	26.2	36	0.378	0.389	OST4_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OST4 PE=1 SV=1
4	W8W3S0	1.9	26.6	1027	0.405	0.015	W8W3S0_SALSA TLR20a protein OS=Salmo salar OX=8030 GN=TLR PE=2 SV=1
5	Q62717	5.1	25.4	1289	0.270	0.008	CAPS1_RAT Calcium-dependent secretion activator 1 OS=Rattus norvegicus OX=10116 GN=Cadps PE=1 SV=1
6	Q80TJ1	5.1	25.4	1355	0.270	0.007	CAPS1_MOUSE Calcium-dependent secretion activator 1 OS=Mus musculus OX=10090 GN=Cadps PE=1 SV=3
7	Q9ULU8	5.1	25.4	1353	0.270	0.007	CAPS1_HUMAN Calcium-dependent secretion activator 1 OS=Homo sapiens OX=9606 GN=CADPS PE=1 SV=3
8	Q7JVE7	9.7	24.6	226	0.297	0.049	SWET1_DROME Sugar transporter SWEET1 OS=Drosophila melanogaster OX=7227 GN=slv PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10215 Ost4	4.5e-14	63.3	Oligosaccaryltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006046267.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006057734.1	0.915	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A isoform X1
2	89462.XP_006063492.1	0.902	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1-like
3	89462.XP_006079034.1	0.902	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
4	89462.XP_006066931.1	0.852	Oligosaccharyltransferase complex subunit OSTC
5	89462.XP_006076291.1	0.852	Oligosaccharyltransferase complex subunit OSTC-like
6	89462.XP_006051786.1	0.812	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
7	89462.XP_006079662.1	0.812	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
8	89462.XP_006045084.1	0.809	60S ribosomal protein L29
9	89462.XP_006045943.1	0.809	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
10	89462.XP_006049341.1	0.809	60S ribosomal protein L35
11	89462.XP_006070127.1	0.809	60S ribosomal protein L8
12	89462.XP_006075303.1	0.809	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
13	89462.XP_006060958.1	0.734	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns
14	89462.XP_006072919.1	0.730	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1-like
15	89462.XP_006077899.1	0.730	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1-like isoform X1
16	89462.XP_006039638.1	0.683	60S ribosomal protein L28-like isoform X1
17	89462.XP_006039668.1	0.683	60S ribosomal protein L18-like
18	89462.XP_006039674.1	0.683	60S ribosomal protein L37a-like
19	89462.XP_006039721.1	0.683	60S acidic ribosomal protein P0-like
20	89462.XP_006039898.1	0.683	60S ribosomal protein L3-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.986	metabolic process
GO:0006487	0.979	protein N-linked glycosylation
GO:0018279	0.362	protein N-linked glycosylation via asparagine

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008250	0.997	oligosaccharyltransferase complex
GO:0043232	0.907	intracellular non-membrane-bounded organelle
GO:0005829	0.441	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]