StarFunc result for job id P0C7I0

User Input

>input (530 residues)
MEDDSLYLGGEWQFNHFSKLTSPRPDAAFAEIQRTSLPEKSPLSSETRVDLCDDLAPVAR
QLAPREKLPLSSRRPAAVGAGLQNMGNTCYLNASLQCLTYTPPLANYMLSREHSQTCQRP
KCCMLCTMQAHITWALHSPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGH
KQVDHHSKDTTLIHQIFGGCWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVKQALEQL
VKPEELNGENAYPCGLCLQRAPASNTLTLHTSAKVLILVLKRFCDVTGNKLAKNVQYPEC
LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGYYFSYVKAQEGQWYKMDDAEVTACSIT
SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRPATQGELKRDHPCLQVPEL
DEHLVERATEESTLDHWKFPQEQNKMKPEFNVRKVEGTLPPNVLVIHQSKYKCGMKNHHP
EQQSSLLNLSSMNSTDQESMNTGTLASLQGRTRRSKGKNKHSKRSLLVCQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0WX57	0.784	0.784	7.473E-95	530	0.940	0.940	Q0WX57.pdb.gz	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	AFDB:Q7M764	0.578	0.567	1.793E-51	540	0.432	0.424	Q7M764.pdb.gz	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
3	AFDB:E9Q9U0	0.569	0.642	1.198E-50	468	0.400	0.453	E9Q9U0.pdb.gz	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
4	AFDB:O74442	0.571	0.660	3.411E-42	457	0.266	0.309	O74442.pdb.gz	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
5	AFDB:Q385P1	0.529	0.373	1.471E-33	765	0.240	0.166	Q385P1.pdb.gz	Q385P1_TRYB2 Ubiquitin carboxyl-terminal hydrolase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.2940 PE=3 SV=1
6	PDB:3mhsA	0.499	0.578	3.265E-30	455	0.181	0.211	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
7	AFDB:E9QFQ5	0.522	0.678	3.501E-30	404	0.185	0.243	E9QFQ5.pdb.gz	E9QFQ5_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=usp21 PE=3 SV=2
8	AFDB:X2JLM6	0.507	0.477	7.138E-30	565	0.200	0.188	X2JLM6.pdb.gz	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
9	AFDB:F1M625	0.503	0.715	1.781E-27	366	0.168	0.243	F1M625.pdb.gz	UBP46_RAT Ubiquitin carboxyl-terminal hydrolase 46 OS=Rattus norvegicus OX=10116 GN=Usp46 PE=1 SV=2
10	AFDB:D3ZN39	0.516	0.262	3.039E-27	1081	0.198	0.097	D3ZN39.pdb.gz	D3ZN39_RAT ubiquitinyl hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Usp8 PE=1 SV=2
11	AFDB:P53874	0.507	0.347	4.885E-27	792	0.187	0.125	P53874.pdb.gz	UBP10_YEAST Ubiquitin carboxyl-terminal hydrolase 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP10 PE=1 SV=2
12	PDB:5cvnB	0.500	0.804	7.770E-27	321	0.155	0.255	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:4fjcE	0.452	0.546	1.681E-26	434	0.166	0.203	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
14	PDB:8a9kD	0.449	0.810	1.916E-25	285	0.134	0.249	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
15	PDB:7ay1D	0.485	0.732	1.529E-24	341	0.143	0.223	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
16	PDB:7yxxA	0.491	0.157	3.952E-24	1754	0.177	0.054	7yxxA.pdb.gz
17	PDB:4wa6D	0.453	0.573	4.450E-24	415	0.158	0.202	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
18	PDB:5k16B	0.478	0.743	2.210E-23	328	0.158	0.256	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
19	PDB:7w3ax	0.458	0.489	6.509E-22	494	0.143	0.154	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
20	PDB:5gjqx	0.465	0.677	2.010E-21	355	0.138	0.206	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0WX57	0.0	1019	530	0.940	0.940	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	Q6QN14	0.0	793	398	0.715	0.952	U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens OX=9606 GN=USP17L6P PE=1 SV=2
3	Q6R6M4	0.0	1069	530	0.962	0.962	U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens OX=9606 GN=USP17L2 PE=1 SV=2
4	G5E8I7	1.59e-144	428	545	0.470	0.457	U17LC_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein C OS=Mus musculus OX=10090 GN=Usp17lc PE=1 SV=1
5	G5E8G2	2.01e-144	428	545	0.453	0.440	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
6	Q61068	1.22e-142	423	526	0.462	0.466	U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus OX=10090 GN=Usp17la PE=1 SV=1
7	E9Q9U0	8.17e-141	416	468	0.430	0.487	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
8	Q7M764	1.46e-140	418	540	0.453	0.444	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
9	Q9H9J4	1.43e-136	429	1324	0.409	0.164	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
10	B2RQC2	1.39e-135	426	1324	0.398	0.159	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
11	E9PEW0	2.19e-123	374	548	0.332	0.321	E9PEW0_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=2
12	E7F4C0	1.75e-118	377	1104	0.340	0.163	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
13	Q9P275	1.99e-117	374	1123	0.330	0.156	UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4
14	B1AQJ2	1.74e-115	369	1098	0.338	0.163	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
15	O74442	3.09e-75	247	457	0.260	0.302	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
16	Q9FPS9	4.34e-67	235	924	0.223	0.128	UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2
17	F4I642	5.25e-67	234	928	0.223	0.127	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
18	Q9SB51	5.53e-55	201	1008	0.206	0.108	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
19	Q9VRP5	1.62e-49	186	1038	0.217	0.111	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
20	Q9FIQ1	3.06e-48	180	732	0.204	0.148	UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana OX=3702 GN=UBP21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04774 HABP4_PAI-RBP1	8.8	18.5	Hyaluronan / mRNA binding family
2	PF18223 PilJ_C	4.1e+02	12.8	Pili PilJ C-terminal domain
3	PF00443 UCH	6.7e-46	168.6	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	8.9e-09	47.0	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485306

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389443	0.903	Ubiquitin carboxyl-terminal hydrolase 17-like protein 12
2	9606.ENSP00000403760	0.903	Ubiquitin carboxyl-terminal hydrolase 17-like protein 10
3	9606.ENSP00000485243	0.903	Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4
4	9606.ENSP00000425955	0.902	Ubiquitin carboxyl-terminal hydrolase 17-like protein 5
5	9606.ENSP00000333329	0.900	Ubiquitin carboxyl-terminal hydrolase 17
6	9606.ENSP00000400880	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 11
7	9606.ENSP00000414392	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 13
8	9606.ENSP00000422216	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 21
9	9606.ENSP00000422621	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 17
10	9606.ENSP00000423115	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 22
11	9606.ENSP00000423503	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 18
12	9606.ENSP00000425582	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 19
13	9606.ENSP00000427264	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 20
14	9606.ENSP00000478980	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 15
15	9606.ENSP00000485323	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 3
16	9606.ENSP00000485364	0.900	Ubiquitin carboxyl-terminal hydrolase 17-like protein 1
17	9606.ENSP00000309163	0.684	CAAX prenyl protease 2
18	9606.ENSP00000333234	0.662	Beta-defensin 108B
19	9606.ENSP00000347810	0.660	Beta-defensin 107
20	9606.ENSP00000334681	0.654	Defensin, beta 107A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005515	0.976	protein binding
GO:0003676	0.855	nucleic acid binding
GO:0003723	0.832	RNA binding
GO:0097367	0.394	carbohydrate derivative binding
GO:0005539	0.332	glycosaminoglycan binding
GO:0005540	0.310	hyaluronic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0016579	0.992	protein deubiquitination
GO:0065007	0.985	biological regulation
GO:0050789	0.980	regulation of biological process
GO:0009987	0.958	cellular process
GO:0050794	0.955	regulation of cellular process
GO:0019222	0.716	regulation of metabolic process
GO:0048518	0.700	positive regulation of biological process
GO:0060255	0.682	regulation of macromolecule metabolic process
GO:0050896	0.491	response to stimulus
GO:0051716	0.459	cellular response to stimulus
GO:0048522	0.446	positive regulation of cellular process
GO:0080090	0.427	regulation of primary metabolic process
GO:0051171	0.427	regulation of nitrogen compound metabolic process
GO:0010468	0.371	regulation of gene expression
GO:0010941	0.366	regulation of cell death
GO:0042981	0.355	regulation of apoptotic process
GO:0048519	0.304	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.996	cytoplasm
GO:0016020	0.984	membrane
GO:0005829	0.981	cytosol
GO:0031981	0.981	nuclear lumen
GO:0012505	0.971	endomembrane system
GO:0043232	0.926	intracellular non-membrane-bounded organelle
GO:0031090	0.868	organelle membrane
GO:0005783	0.862	endoplasmic reticulum
GO:0098827	0.845	endoplasmic reticulum subcompartment
GO:0005789	0.832	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]