StarFunc result for job id P0C7M7

User Input

>input (580 residues)
MKIFFRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADVLD
QWSQKEKTGERPANPALWWVNGKGDEVKWSFRELGSLSRKAANVLTKPCGLQRGDRLAVI
LPRIPEWWLVNVACIRTGIIFMPGTIQLTAKDILYRLRASKAKCIVASEEVAPAVESIVL
ECPDLKTKLLVSPQSWNGWLSFQELFQFASEEHSCVETGSQEPMTIYFTSGTTGFPKMAQ
HSQSSLGIGFTLCGRYWLDLKSSDIIWNMSDTGWVKAAIGSVFSSWLCGACVFVHRMAQF
DTDTFLDTLTTYPITTLCSPPTVYRMLVQKDLKRYKFKSLRHCLTGGEPLNPEVLEQWRV
QTGLELYEGYGQTEVGMICANQKGQEIKPGSMGKGMLPYDVQIIDENGNVLPPGKEGEIA
LRLKPTRPFCFFSKYVDNPQKTAATIRGDFYVTGDRGVMDSDGYFWFVGRADDVIISSGY
RIGPFEVESALIEHPAVVESAVVSSPDQIRGEVVKAFVVLAAPFKSYNPEKLTLELQDHV
KKSTAPYKYPRKVEFVQELPKTITGKIKRNVLRDQEWRGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TN78	0.960	0.960	0.000	580	0.859	0.859	Q7TN78.pdb.gz	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
2	AFDB:Q53FZ2	0.921	0.911	5.829E-92	586	0.597	0.590	Q53FZ2.pdb.gz	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
3	AFDB:Q3UNX5	0.756	0.756	6.742E-91	580	0.591	0.591	Q3UNX5.pdb.gz	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
4	AFDB:Q08AH3	0.745	0.748	2.651E-87	577	0.572	0.575	Q08AH3.pdb.gz	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
5	AFDB:Q9BEA2	0.925	0.929	9.017E-87	577	0.557	0.560	Q9BEA2.pdb.gz	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
6	AFDB:Q8K0L3	0.747	0.753	2.729E-86	575	0.547	0.551	Q8K0L3.pdb.gz	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
7	PDB:3b7wA	0.744	0.801	1.403E-84	537	0.566	0.611	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
8	AFDB:Q08AH1	0.750	0.754	7.133E-81	577	0.548	0.551	Q08AH1.pdb.gz	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
9	AFDB:Q91VA0	0.744	0.753	2.097E-79	573	0.521	0.527	Q91VA0.pdb.gz	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
10	AFDB:Q729U8	0.884	0.930	5.014E-67	551	0.402	0.423	Q729U8.pdb.gz	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
11	AFDB:A4YDT1	0.863	0.887	1.430E-58	564	0.343	0.353	A4YDT1.pdb.gz	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
12	PDB:1ry2A	0.835	0.789	6.344E-48	615	0.252	0.237	1ry2A.pdb.gz	Crystal structure of yeast acetyl-coenzyme A synthetase in complex with AMP
13	PDB:2p20A	0.683	0.622	4.095E-45	641	0.245	0.222	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
14	PDB:6q2mA	0.805	0.856	1.103E-44	544	0.224	0.239	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
15	PDB:5bsmA	0.794	0.865	2.495E-44	530	0.245	0.268	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
16	PDB:5ie2A	0.763	0.869	2.803E-44	506	0.219	0.251	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
17	PDB:3r44A	0.671	0.768	5.320E-42	502	0.219	0.253	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
18	PDB:1ultA	0.686	0.742	1.010E-41	533	0.216	0.235	1ultA.pdb.gz
19	PDB:7kydA	0.779	0.843	1.392E-40	534	0.210	0.228	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
20	PDB:3rg2C	0.670	0.636	1.391E-36	613	0.193	0.183	3rg2C.pdb.gz	Structural and Functional Investigation of the Intermolecular Interaction between NRPS Adenylation and Carrier Protein Domains.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08AH1	0.0	645	577	0.547	0.549	ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM1 PE=1 SV=1
2	Q08AH3	0.0	692	577	0.562	0.565	ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2A PE=1 SV=2
3	Q3UNX5	0.0	762	580	0.595	0.595	ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus OX=10090 GN=Acsm3 PE=1 SV=2
4	Q53FZ2	0.0	763	586	0.591	0.585	ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM3 PE=1 SV=2
5	Q68CK6	0.0	697	577	0.560	0.563	ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens OX=9606 GN=ACSM2B PE=1 SV=2
6	Q7TN78	0.0	1055	580	0.859	0.859	ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acsm4 PE=1 SV=1
7	Q80W40	0.0	1058	580	0.864	0.864	ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus OX=10090 GN=Acsm4 PE=2 SV=1
8	Q8K0L3	0.0	670	575	0.548	0.553	ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus OX=10090 GN=Acsm2 PE=1 SV=1
9	Q91VA0	0.0	639	573	0.517	0.524	ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus OX=10090 GN=Acsm1 PE=1 SV=1
10	Q9BEA2	0.0	672	577	0.564	0.567	ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus OX=9913 GN=ACSM1 PE=1 SV=2
11	Q729U8	1.37e-147	438	551	0.405	0.426	Q729U8_DESVH AMP-binding protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_2250 PE=1 SV=1
12	A4YDT1	1.24e-102	323	564	0.340	0.349	HBCL1_METS5 4-hydroxybutyrate--CoA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_0406 PE=1 SV=1
13	P27550	8.75e-60	212	652	0.279	0.248	ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) OX=83333 GN=acs PE=1 SV=2
14	Q726Y7	9.35e-60	212	661	0.274	0.241	Q726Y7_DESVH Acetyl-coenzyme A synthetase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=acsA PE=1 SV=1
15	Q99NB1	4.06e-55	199	682	0.290	0.246	ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus OX=10090 GN=Acss1 PE=1 SV=1
16	Q8ZKF6	1.72e-54	197	652	0.272	0.242	ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=acs PE=1 SV=1
17	D3ZZN3	2.03e-54	197	682	0.279	0.238	D3ZZN3_RAT Acetyl-coenzyme A synthetase OS=Rattus norvegicus OX=10116 GN=Acss1 PE=3 SV=1
18	Q01574	1.93e-53	196	713	0.259	0.210	ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACS1 PE=1 SV=2
19	Q9NUB1	2.98e-53	194	689	0.281	0.237	ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS1 PE=1 SV=2
20	P9WQD1	1.20e-52	192	651	0.278	0.247	ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=acsA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	1.7e-77	272.5	AMP-binding enzyme
2	PF13193 AMP-binding_C	1.6e-18	78.7	AMP-binding enzyme C-terminal domain
3	PF08694 UFC1	4.3e+02	12.0	Ubiquitin-fold modifier-conjugating enzyme 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382349

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242592	0.925	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
2	9606.ENSP00000278840	0.902	Fatty acid desaturase 2
3	9606.ENSP00000369860	0.760	Motile sperm domain-containing protein 2
4	9606.ENSP00000442770	0.760	GPN-loop GTPase 3
5	9606.ENSP00000278937	0.689	Myelin protein zero-like protein 2
6	9606.ENSP00000356465	0.688	Ras-related protein Rab-32
7	9606.ENSP00000340445	0.650	Stabilizer of axonemal microtubules 2
8	9606.ENSP00000364643	0.557	BPI fold-containing family B member 3
9	9606.ENSP00000481684	0.536	Fatty acid desaturase 6
10	9606.ENSP00000349428	0.510	Polypyrimidine tract-binding protein 1
11	9606.ENSP00000342056	0.509	Citrate synthase, mitochondrial
12	9606.ENSP00000359216	0.503	Polypyrimidine tract-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016405	1.000	CoA-ligase activity
GO:0015645	0.997	fatty acid ligase activity
GO:0005488	0.796	binding
GO:0016740	0.762	transferase activity
GO:0016747	0.747	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0016408	0.706	C-acyltransferase activity
GO:0004467	0.648	long-chain fatty acid-CoA ligase activity
GO:0005515	0.634	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0044238	0.987	primary metabolic process
GO:0044281	0.977	small molecule metabolic process
GO:0019637	0.933	organophosphate metabolic process
GO:0006807	0.885	nitrogen compound metabolic process
GO:0043603	0.880	amide metabolic process
GO:1901564	0.782	organonitrogen compound metabolic process
GO:1901135	0.759	carbohydrate derivative metabolic process
GO:0019693	0.716	ribose phosphate metabolic process
GO:0006637	0.701	acyl-CoA metabolic process
GO:0006629	0.568	lipid metabolic process
GO:0006082	0.509	organic acid metabolic process
GO:0019752	0.447	carboxylic acid metabolic process
GO:0006631	0.317	fatty acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0043233	0.866	organelle lumen
GO:0070013	0.837	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.1.-	1.000	Acid--thiol ligases.
EC:2.-.-.-	0.762	Transferases.
EC:2.3.1.-	0.747	Transferring groups other than amino-acyl groups.
RHEA:15421	0.648	a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate
EC:6.2.1.3	0.648	long-chain-fatty-acid--CoA ligase.

[back to server]