StarFunc result for job id P0C7P1

User Input

>input (496 residues)
MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPAD
AKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTR
GWLPSQEGHLDDGGYTPDLKMSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGS
QGPMSQRRENYGVPPRRATISSWRNDRMSTRHDGYATNDGNHPSCQETRDYAPPSRGYAY
RDNGHSNRDEHSSRGYRNHRSSRETRDYAPPSRGHAYRDYGHSRRDESYSRGYRNRRSSR
ETREYAPPSRGHGYRDYGHSRRHESYSRGYRNHPSSRETRDYAPPHRDYAYRDYGHSSWD
EHSSRGYSYHDGYGEALGRDHSEHLSGSSYRDALQRYGTSHGAPPARGPRMSYGGSTCHA
YSNTRDRYGRSWESYSSCGDFHYCDREHVCRKDQRNPPSLGRVLPDPREACGSSSYVASI
VDGGESRSEKGDSSRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6NDE4	0.376	0.376	1.345E-64	496	0.998	0.998	A6NDE4.pdb.gz	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
2	AFDB:J3KPK3	0.218	0.235	8.543E-58	459	0.923	0.998	J3KPK3.pdb.gz	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
3	AFDB:P38159	0.193	0.242	6.198E-28	391	0.484	0.614	P38159.pdb.gz	RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3
4	AFDB:O35698	0.180	0.233	2.248E-19	380	0.298	0.389	O35698.pdb.gz	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
5	PDB:5yzg1	0.154	0.312	3.319E-9	243	0.065	0.132	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
6	PDB:7dvqY	0.152	0.525	3.774E-9	140	0.056	0.200	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
7	AFDB:F4JYK6	0.170	0.186	8.841E-9	453	0.145	0.159	F4JYK6.pdb.gz	F4JYK6_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=MNJ7.21 PE=1 SV=1
8	PDB:6y53o	0.155	0.472	1.124E-8	160	0.054	0.169	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
9	PDB:6qx91K	0.164	0.394	1.278E-8	201	0.058	0.144	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
10	AFDB:E9PYH6	0.155	0.050	1.478E-8	1716	0.202	0.058	E9PYH6.pdb.gz	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
11	AFDB:Q9UPS6	0.168	0.051	2.994E-8	1966	0.208	0.052	Q9UPS6.pdb.gz	SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B PE=1 SV=3
12	PDB:3lqvB	0.155	0.634	3.139E-8	115	0.040	0.174	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:5gm6V	0.164	0.608	3.348E-8	128	0.054	0.211	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	AFDB:E7EX17	0.159	0.129	3.870E-8	616	0.179	0.144	E7EX17.pdb.gz	E7EX17_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=1
15	AFDB:A0A087X0X3	0.161	0.111	4.127E-8	730	0.163	0.111	A0A087X0X3.pdb.gz	A0A087X0X3_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM PE=1 SV=1
16	AFDB:Q1LY77	0.186	0.055	4.127E-8	1844	0.204	0.055	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
17	PDB:6n7pA	0.159	0.416	1.134E-7	186	0.052	0.140	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
18	PDB:5xjcw	0.151	0.800	1.895E-7	91	0.044	0.242	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
19	PDB:6gd1A	0.155	0.399	2.449E-7	190	0.050	0.132	6gd1A.pdb.gz
20	PDB:6g90B	0.164	0.411	2.612E-7	193	0.054	0.140	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NDE4	0.0	988	496	0.998	0.998	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
2	A6NEQ0	0.0	991	496	0.998	0.998	RBY1E_HUMAN RNA-binding motif protein, Y chromosome, family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=1 SV=1
3	J3KPK3	0.0	899	459	0.923	0.998	J3KPK3_HUMAN RNA binding motif protein Y-linked family 1 member E OS=Homo sapiens OX=9606 GN=RBMY1E PE=4 SV=1
4	J3KQ82	0.0	887	459	0.915	0.989	J3KQ82_HUMAN RNA binding motif protein Y-linked family 1 member F OS=Homo sapiens OX=9606 GN=RBMY1F PE=4 SV=1
5	P0C7P1	0.0	992	496	1.000	1.000	RBY1D_HUMAN RNA-binding motif protein, Y chromosome, family 1 member D OS=Homo sapiens OX=9606 GN=RBMY1D PE=2 SV=1
6	P0DJD3	0.0	989	496	0.998	0.998	RBY1A_HUMAN RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Homo sapiens OX=9606 GN=RBMY1A1 PE=1 SV=1
7	P0DJD4	0.0	988	496	0.996	0.996	RBY1C_HUMAN RNA-binding motif protein, Y chromosome, family 1 member C OS=Homo sapiens OX=9606 GN=RBMY1C PE=1 SV=1
8	Q15415	0.0	978	496	0.990	0.990	RBY1F_HUMAN RNA-binding motif protein, Y chromosome, family 1 member F/J OS=Homo sapiens OX=9606 GN=RBMY1F PE=1 SV=2
9	Q91VM5	6.96e-81	258	388	0.343	0.438	RMXL1_MOUSE RNA binding motif protein, X-linked-like-1 OS=Mus musculus OX=10090 GN=Rbmxl1 PE=2 SV=1
10	Q4V898	2.42e-80	257	390	0.335	0.426	RBMX_RAT RNA-binding motif protein, X chromosome OS=Rattus norvegicus OX=10116 GN=Rbmx PE=1 SV=1
11	P84586	8.89e-80	255	388	0.339	0.433	RMXRL_RAT RNA-binding motif protein, X chromosome retrogene-like OS=Rattus norvegicus OX=10116 GN=Rbmxrtl PE=1 SV=1
12	P38159	6.55e-78	251	391	0.335	0.425	RBMX_HUMAN RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX PE=1 SV=3
13	O35698	4.25e-52	182	380	0.252	0.329	RBY1A_MOUSE RNA-binding motif protein, Y chromosome, family 1 member A1 OS=Mus musculus OX=10090 GN=Rbmy1a1 PE=1 SV=2
14	K7EPM4	1.20e-26	107	168	0.099	0.292	K7EPM4_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
15	P60824	1.58e-26	107	172	0.099	0.285	CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus OX=10090 GN=Cirbp PE=1 SV=1
16	P60825	1.58e-26	107	172	0.099	0.285	CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus OX=10116 GN=Cirbp PE=2 SV=1
17	K7EMY9	1.62e-26	107	159	0.099	0.308	K7EMY9_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
18	Q14011	1.63e-26	107	172	0.099	0.285	CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
19	Q53XX5	1.63e-26	107	172	0.099	0.285	Q53XX5_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=2 SV=1
20	Q9DED4	1.64e-26	107	166	0.099	0.295	CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis OX=8355 GN=cirbp-b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08081 RBM1CTR	1.1e-18	78.2	RBM1CTR (NUC064) family
2	PF00076 RRM_1	3.5e-18	76.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF13893 RRM_5	10	17.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	1.7e+02	13.7	RNA recognition motif
5	PF16842 RRM_occluded	91	14.4	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000060317

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000048388	0.800	Uncharacterized protein
2	9598.ENSPTRP00000048393	0.800	Uncharacterized protein
3	9598.ENSPTRP00000060371	0.800	Uncharacterized protein
4	9598.ENSPTRP00000027026	0.743	Transformer 2 beta homolog
5	9598.ENSPTRP00000048426	0.739	Uncharacterized protein
6	9598.ENSPTRP00000060395	0.738	Pan troglodytes chromodomain protein, Y-linked, 1 (CDY1), mRNA
7	9598.ENSPTRP00000046641	0.733	Heterogeneous nuclear ribonucleoprotein C (C1/C2)
8	9598.ENSPTRP00000042216	0.730	Polypyrimidine tract binding protein 1
9	9598.ENSPTRP00000017736	0.717	Heterogeneous nuclear ribonucleoprotein M
10	9598.ENSPTRP00000000569	0.703	Heterogeneous nuclear ribonucleoprotein R
11	9598.ENSPTRP00000032472	0.687	Heterogeneous nuclear ribonucleoprotein A2/B1
12	9598.ENSPTRP00000018758	0.671	Heterogeneous nuclear ribonucleoprotein L
13	9598.ENSPTRP00000016036	0.638	Pan troglodytes serine/arginine-rich splicing factor 1 (SRSF1), mRNA
14	9598.ENSPTRP00000048014	0.636	Heterogeneous nuclear ribonucleoprotein A0
15	9598.ENSPTRP00000050686	0.618	Pan troglodytes heterogeneous nuclear ribonucleoprotein F (HNRNPF), mRNA
16	9598.ENSPTRP00000048403	0.557	Uncharacterized protein
17	9598.ENSPTRP00000037628	0.556	Uncharacterized protein
18	9598.ENSPTRP00000027859	0.552	Uncharacterized protein
19	9598.ENSPTRP00000038035	0.547	Pan troglodytes heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), mRNA
20	9598.ENSPTRP00000003693	0.546	Heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0042802	0.998	identical protein binding
GO:0003729	0.993	mRNA binding
GO:0003677	0.802	DNA binding
GO:0043565	0.512	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0043484	0.980	regulation of RNA splicing
GO:1903311	0.809	regulation of mRNA metabolic process
GO:0050684	0.473	regulation of mRNA processing
GO:0048024	0.456	regulation of mRNA splicing, via spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.979	nucleolus
GO:0032991	0.919	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]