StarFunc result for job id P0C7P3

User Input

>input (912 residues)
MESLKTDTEMPYPEVIVDVGRVIFGEENRKKMTNSCLKRSENSRIIRAICALLNSGGGVI
KAEIDDKTYSYQCHGLGQDLETSFQKLLPSGSQKYLDYMQQGHNLLIFVKSWSPDVFSLP
LRICSLRSNLYRRDVTSAINLSASSALELLREKGFRAQRGRPRVKKLHPQQVLNRCIQEE
EDMRILASEFFKKDKLMYKEKLNFTESTHVEFKRFTTKKVIPRIKEMLPHYVSAFANTQG
GYVLIGVDDKSKEVVGCKWEKVNPDLLKKEIENCIEKLPTFHFCCEKPKVNFTTKILNVY
QKDVLDGYVCVIQVEPFCCVVFAEAPDSWIMKDNSVTRLTAEQWVVMMLDTQSAPPSLVT
DYNSCLISSASSARKSPGYPIKVHKFKEALQRHLFPVTQEEVQFKPESLCKKLFSDHKEL
EGLMKTLIHPCSQGIVIFSRSWAGDVGFRKEQNVLCDALLIAVNSPVVLYTILIDPNWPG
GLEYARNTAHQLKQKLQTVGGYTGKVCIIPRLIHLSSTQSRPGEIPLRYPRSYRLADEEE
MEDLLQALVVVSLSSRSLLSDQMGCEFFNLLIMEQSQLLSESLQKTRELFIYCFPGVRKT
ALAIKIMEKIKDLFHCKPKEILYVCESDSLKDFVTQQTTCQAVTRKTFMQGEFLKIKHIV
MDETENFCSKYGNWYMKAKNITHPKAKGTGSENLHHGILWLFLDPFQIHHADVNGLPPPS
AQFPRKTITSGIHCALEIAKVMKEEMKRIKENPPSNMSPDTLALFSETAYEEATCAQALP
GVCETKTNLTTEQIANYVARKCHSLFQCGYLPKDIAILCRRGEDRGRYRLALLKAMELIE
THRPSEVVFSPATGVWGSHIVLDSIQQFSGLERTVVFGLSPECDQSEEFHKLCFASRAIK
HLYLLYEKRAAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G1SRW8	0.963	0.960	0.000	915	0.774	0.772	G1SRW8.pdb.gz	SLN14_RABIT Protein SLFN14 OS=Oryctolagus cuniculus OX=9986 GN=SLFN14 PE=1 SV=2
2	AFDB:P0C7P3	1.000	1.000	0.000	912	1.000	1.000	P0C7P3.pdb.gz	SLN14_HUMAN Protein SLFN14 OS=Homo sapiens OX=9606 GN=SLFN14 PE=1 SV=2
3	AFDB:V9GXG1	0.958	0.972	0.000	899	0.694	0.704	V9GXG1.pdb.gz	SLN14_MOUSE Protein SLFN14 OS=Mus musculus OX=10090 GN=Slfn14 PE=1 SV=1
4	PDB:7zelA	0.855	0.941	3.421E-100	827	0.427	0.470	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
5	AFDB:Q68D06	0.555	0.564	7.419E-99	897	0.423	0.430	Q68D06.pdb.gz	SLN13_HUMAN Schlafen family member 13 OS=Homo sapiens OX=9606 GN=SLFN13 PE=1 SV=1
6	AFDB:Q7Z7L1	0.552	0.558	1.686E-98	901	0.429	0.434	Q7Z7L1.pdb.gz	SLN11_HUMAN Schlafen family member 11 OS=Homo sapiens OX=9606 GN=SLFN11 PE=1 SV=2
7	AFDB:Q5U311	0.554	0.557	2.721E-94	907	0.416	0.418	Q5U311.pdb.gz	SLN13_RAT Schlafen family member 13 OS=Rattus norvegicus OX=10116 GN=Slfn13 PE=1 SV=1
8	AFDB:B1ARD6	0.556	0.557	1.061E-91	910	0.413	0.414	B1ARD6.pdb.gz	SLFN9_MOUSE Schlafen family member 9 OS=Mus musculus OX=10090 GN=Slfn9 PE=2 SV=1
9	AFDB:B1ARD8	0.555	0.556	4.897E-90	910	0.406	0.407	B1ARD8.pdb.gz	SLFN8_MOUSE Schlafen family member 8 OS=Mus musculus OX=10090 GN=Slfn8 PE=2 SV=1
10	AFDB:Q8CBA2	0.533	0.549	8.436E-89	884	0.379	0.391	Q8CBA2.pdb.gz	SLFN5_MOUSE Schlafen family member 5 OS=Mus musculus OX=10090 GN=Slfn5 PE=1 SV=2
11	AFDB:Q8IYM2	0.524	0.810	4.415E-61	578	0.268	0.422	Q8IYM2.pdb.gz	SLN12_HUMAN Ribonuclease SLFN12 OS=Homo sapiens OX=9606 GN=SLFN12 PE=1 SV=2
12	PDB:7lrdA	0.507	0.887	2.630E-57	512	0.257	0.457	7lrdA.pdb.gz	Structure of PDE3A-SLFN12 complex reveals requirements for activation of SLFN12 RNase.
13	PDB:7eg0B	0.527	0.834	5.956E-56	567	0.261	0.420	7eg0B.pdb.gz	Structure of PDE3A-SLFN12 complex and structure-based design for a potent apoptosis inducer of tumor cells.
14	PDB:2is4B	0.242	0.337	4.497E-8	632	0.069	0.100	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
15	PDB:3k70D	0.203	0.306	7.773E-8	547	0.067	0.112	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
16	PDB:5eanA	0.222	0.195	9.676E-8	1051	0.052	0.045	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
17	PDB:5ld2D	0.217	0.305	1.140E-7	605	0.086	0.129	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
18	PDB:2is6A	0.247	0.335	1.204E-7	654	0.064	0.089	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
19	PDB:3upuA	0.237	0.449	8.181E-7	439	0.041	0.084	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.
20	PDB:5aorA	0.190	0.175	1.018E-6	1009	0.056	0.051	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1ARD6	0.0	674	910	0.428	0.429	SLFN9_MOUSE Schlafen family member 9 OS=Mus musculus OX=10090 GN=Slfn9 PE=2 SV=1
2	B1ARD8	0.0	660	910	0.421	0.422	SLFN8_MOUSE Schlafen family member 8 OS=Mus musculus OX=10090 GN=Slfn8 PE=2 SV=1
3	G1SRW8	0.0	1458	915	0.773	0.770	SLN14_RABIT Protein SLFN14 OS=Oryctolagus cuniculus OX=9986 GN=SLFN14 PE=1 SV=2
4	P0C7P3	0.0	1901	912	1.000	1.000	SLN14_HUMAN Protein SLFN14 OS=Homo sapiens OX=9606 GN=SLFN14 PE=1 SV=2
5	Q5U311	0.0	667	907	0.427	0.429	SLN13_RAT Schlafen family member 13 OS=Rattus norvegicus OX=10116 GN=Slfn13 PE=1 SV=1
6	Q68D06	0.0	711	897	0.433	0.440	SLN13_HUMAN Schlafen family member 13 OS=Homo sapiens OX=9606 GN=SLFN13 PE=1 SV=1
7	Q7Z7L1	0.0	682	901	0.439	0.444	SLN11_HUMAN Schlafen family member 11 OS=Homo sapiens OX=9606 GN=SLFN11 PE=1 SV=2
8	Q8CBA2	0.0	603	884	0.399	0.412	SLFN5_MOUSE Schlafen family member 5 OS=Mus musculus OX=10090 GN=Slfn5 PE=1 SV=2
9	V9GXG1	0.0	1315	899	0.698	0.709	SLN14_MOUSE Protein SLFN14 OS=Mus musculus OX=10090 GN=Slfn14 PE=1 SV=1
10	Q8IYM2	5.58e-146	446	578	0.273	0.431	SLN12_HUMAN Ribonuclease SLFN12 OS=Homo sapiens OX=9606 GN=SLFN12 PE=1 SV=2
11	Q3UV10	1.30e-88	296	602	0.208	0.316	Q3UV10_MOUSE Schlafen AlbA-2 domain-containing protein OS=Mus musculus OX=10090 GN=Slfn4 PE=2 SV=1
12	Q3UV66	1.41e-88	296	602	0.208	0.316	Q3UV66_MOUSE Schlafen 4 OS=Mus musculus OX=10090 GN=Slfn4 PE=1 SV=1
13	B2RWZ6	1.46e-88	296	602	0.208	0.316	B2RWZ6_MOUSE Schlafen 4 OS=Mus musculus OX=10090 GN=Slfn4 PE=2 SV=1
14	Q9Z0I6	5.12e-87	285	378	0.159	0.384	SLFN2_MOUSE Schlafen family member 2 OS=Mus musculus OX=10090 GN=Slfn2 PE=1 SV=1
15	A0A1L1STQ7	6.40e-86	290	640	0.208	0.297	A0A1L1STQ7_MOUSE Schlafen 3 OS=Mus musculus OX=10090 GN=Slfn3 PE=1 SV=1
16	Q9TPX1	6.71e-83	280	587	0.209	0.325	Q9TPX1_RAT Schlafen family member 4 OS=Rattus norvegicus OX=10116 GN=Slfn4 PE=4 SV=1
17	Q9Z0I5	7.19e-80	270	517	0.200	0.352	Q9Z0I5_MOUSE Schlafen 3 OS=Mus musculus OX=10090 GN=Slfn3 PE=1 SV=1
18	Q9Z0I7	3.89e-78	259	337	0.157	0.424	SLFN1_MOUSE Schlafen family member 1 OS=Mus musculus OX=10090 GN=Slfn1 PE=1 SV=1
19	A0A0G2K4S0	1.24e-76	262	558	0.192	0.314	A0A0G2K4S0_RAT Schlafen family member 4 OS=Rattus norvegicus OX=10116 GN=Slfn4 PE=4 SV=2
20	Q3V0E6	6.21e-72	244	393	0.163	0.379	Q3V0E6_MOUSE Schlafen AlbA-2 domain-containing protein OS=Mus musculus OX=10090 GN=Slfn3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04326 AlbA_2	1.3e-17	75.6	Putative DNA-binding domain
2	PF17057 B3R	3.2e+02	12.9	Poxviridae B3 protein
3	PF13592 HTH_33	29	15.7	Winged helix-turn helix
4	PF13734 Inhibitor_I69	1.1e+02	14.6	Spi protease inhibitor
5	PF13538 UvrD_C_2	7.5	17.8	UvrD-like helicase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000026988

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000027037	0.530	Actin filament associated protein 1-like 1
2	9612.ENSCAFP00000027029	0.529	Prenylcysteine oxidase 1 like
3	9612.ENSCAFP00000012876	0.526	Mitogen-activated protein kinase-activated protein kinase 5
4	9612.ENSCAFP00000036307	0.518	Leucine rich repeat and Ig domain containing 2
5	9612.ENSCAFP00000017729	0.515	Adenosine deaminase-like
6	9612.ENSCAFP00000028186	0.506	VPS53, GARP complex subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043022	1.000	ribosome binding
GO:0004521	1.000	RNA endonuclease activity
GO:0005515	0.971	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.989	regulation of biological process
GO:0016075	0.979	rRNA catabolic process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0048519	0.964	negative regulation of biological process
GO:0010468	0.882	regulation of gene expression
GO:0010605	0.859	negative regulation of macromolecule metabolic process
GO:0016071	0.591	mRNA metabolic process
GO:0048856	0.556	anatomical structure development
GO:0050896	0.543	response to stimulus
GO:0050794	0.444	regulation of cellular process
GO:0010629	0.314	negative regulation of gene expression
GO:0051716	0.310	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.957	cytoplasm
GO:0005829	0.319	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]