StarFunc result for job id P0C7P4

User Input

>input (283 residues)
MQQIYTVKEIRSVAARSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLS
RESLSGQAVRRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESTEARK
GFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRG
KPLFVRHRTQKEIKQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDF
GGYYCPCHGSHYDASGRIRLGPATLNLEVPTYEFTSDDMVIVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47985	0.813	0.838	3.567E-53	274	0.947	0.978	P47985.pdb.gz	UCRI_HUMAN Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRFS1 PE=1 SV=2
2	AFDB:P20788	0.700	0.723	5.401E-49	274	0.859	0.887	P20788.pdb.gz	UCRI_RAT Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrfs1 PE=1 SV=2
3	AFDB:Q9VQ29	0.691	0.847	2.383E-34	230	0.495	0.609	Q9VQ29.pdb.gz	Q9VQ29_DROME Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Drosophila melanogaster OX=7227 GN=RFeSP PE=1 SV=3
4	AFDB:O44512	0.681	0.698	7.014E-32	276	0.445	0.457	O44512.pdb.gz	O44512_CAEEL Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=isp-1 PE=1 SV=1
5	AFDB:A0A1D8PJX3	0.643	0.847	2.449E-30	213	0.389	0.516	A0A1D8PJX3.pdb.gz	A0A1D8PJX3_CANAL Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIP1 PE=1 SV=1
6	AFDB:Q09154	0.631	0.778	1.814E-29	228	0.392	0.487	Q09154.pdb.gz	UCRI_SCHPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rip1 PE=2 SV=2
7	AFDB:Q9LYR2	0.587	0.605	3.692E-29	274	0.364	0.376	Q9LYR2.pdb.gz	UCRI2_ARATH Cytochrome b-c1 complex subunit Rieske-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCR1-2 PE=1 SV=1
8	AFDB:P08067	0.639	0.834	7.044E-29	215	0.357	0.470	P08067.pdb.gz	UCRI_YEAST Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIP1 PE=1 SV=1
9	AFDB:P49729	0.594	0.650	2.918E-28	258	0.378	0.415	P49729.pdb.gz	UCRI1_TOBAC Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (Fragment) OS=Nicotiana tabacum OX=4097 PE=2 SV=1
10	AFDB:P49727	0.600	0.622	3.320E-28	273	0.399	0.414	P49727.pdb.gz	UCRI_MAIZE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Zea mays OX=4577 PE=2 SV=1
11	PDB:6giqE	0.573	0.840	1.145E-26	185	0.350	0.535	6giqE.pdb.gz	Cryo-EM structure of the yeast respiratory supercomplex.
12	PDB:7rjaC	0.581	0.883	4.874E-22	181	0.367	0.575	7rjaC.pdb.gz	Rieske head domain dynamics and indazole-derivative inhibition of Candida albicans complex III.
13	PDB:7e1vM	0.332	0.254	2.915E-5	378	0.117	0.087	7e1vM.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.
14	PDB:4qdcA	0.263	0.208	4.121E-4	369	0.081	0.062	4qdcA.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.
15	PDB:2qpzA	0.266	0.634	5.336E-4	103	0.092	0.252	2qpzA.pdb.gz	Determining Rieske cluster reduction potentials.
16	PDB:4nbbE	0.282	0.611	6.477E-4	114	0.085	0.211	4nbbE.pdb.gz	Structural basis of the divergent oxygenation reactions catalyzed by the rieske nonheme iron oxygenase carbazole 1,9a-dioxygenase.
17	PDB:2bmoA	0.285	0.193	1.158E-3	437	0.092	0.059	2bmoA.pdb.gz	Structural insight into the dioxygenation of nitroarene compounds: the crystal structure of nitrobenzene dioxygenase.
18	PDB:2zylA	0.253	0.206	1.707E-3	359	0.088	0.070	2zylA.pdb.gz	Characterization of 3-ketosteroid 9{alpha}-hydroxylase, a Rieske oxygenase in the cholesterol degradation pathway of Mycobacterium tuberculosis
19	PDB:1eg9A	0.286	0.188	2.210E-3	447	0.067	0.043	1eg9A.pdb.gz	Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
20	PDB:4qdfB	0.243	0.199	2.862E-3	357	0.088	0.070	4qdfB.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47985	0.0	552	274	0.947	0.978	UCRI_HUMAN Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRFS1 PE=1 SV=2
2	P20788	2.51e-175	486	274	0.859	0.887	UCRI_RAT Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrfs1 PE=1 SV=2
3	Q9CR68	8.10e-174	482	274	0.848	0.876	UCRI_MOUSE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrfs1 PE=1 SV=1
4	Q9VQ29	1.38e-90	270	230	0.470	0.578	Q9VQ29_DROME Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Drosophila melanogaster OX=7227 GN=RFeSP PE=1 SV=3
5	A0A1D8PJX3	8.45e-79	239	213	0.371	0.493	A0A1D8PJX3_CANAL Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIP1 PE=1 SV=1
6	O44512	3.63e-76	235	276	0.463	0.475	O44512_CAEEL Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=isp-1 PE=1 SV=1
7	P08067	1.75e-74	228	215	0.360	0.474	UCRI_YEAST Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIP1 PE=1 SV=1
8	Q09154	1.41e-73	226	228	0.364	0.452	UCRI_SCHPO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rip1 PE=2 SV=2
9	P49729	4.19e-65	206	258	0.318	0.349	UCRI1_TOBAC Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (Fragment) OS=Nicotiana tabacum OX=4097 PE=2 SV=1
10	P49727	1.73e-64	205	273	0.318	0.330	UCRI_MAIZE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Zea mays OX=4577 PE=2 SV=1
11	Q9LYR2	1.78e-62	200	274	0.307	0.318	UCRI2_ARATH Cytochrome b-c1 complex subunit Rieske-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCR1-2 PE=1 SV=1
12	Q94JS0	1.89e-62	200	272	0.304	0.316	UCRI1_ARATH Cytochrome b-c1 complex subunit Rieske-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UCR1-1 PE=1 SV=1
13	Q38D40	1.04e-36	134	297	0.240	0.229	Q38D40_TRYB2 Reiske iron-sulfur protein, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.4700 PE=3 SV=1
14	Q9ZR03	6.85e-08	54.3	229	0.085	0.105	UCRIA_ARATH Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=petC PE=1 SV=1
15	Q7X9A6	5.12e-07	51.6	222	0.088	0.113	UCRIA_WHEAT Cytochrome b6-f complex iron-sulfur subunit, chloroplastic OS=Triticum aestivum OX=4565 GN=petC PE=2 SV=1
16	A8J9Y1	5.58e-07	51.2	206	0.092	0.126	A8J9Y1_CHLRE Uncharacterized protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_11g467689v5 PE=1 SV=1
17	P9WH23	0.40	34.7	429	0.102	0.068	QCRA_MYCTU Cytochrome bc1 complex Rieske iron-sulfur subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=qcrA PE=1 SV=1
18	G5EB15	0.65	33.9	360	0.074	0.058	G5EB15_EMENI Isopropylmalate dehydrogenase-like domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05206 PE=3 SV=1
19	Q03132	1.0	33.5	3567	0.057	0.004	ERYA2_SACER 6-deoxyerythronolide-B synthase EryA2, modules 3 and 4 OS=Saccharopolyspora erythraea OX=1836 GN=eryA PE=1 SV=3
20	O73613	1.1	33.1	616	0.078	0.036	O73613_XENLA Mitogen-activated protein kinase kinase kinase 7 OS=Xenopus laevis OX=8355 GN=map3k7.L PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00355 Rieske	2.8e-08	44.9	Rieske [2Fe-2S] domain
2	PF04265 TPK_B1_binding	3.6e+02	12.3	Thiamin pyrophosphokinase, vitamin B1 binding domain
3	PF09165 Ubiq-Cytc-red_N	3e-20	84.1	Ubiquinol-cytochrome c reductase 8 kDa, N-terminal
4	PF02921 UCR_TM	2e-26	103.4	Ubiquinol cytochrome reductase transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003816278.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003806186.1	0.999	Cytochrome c oxidase subunit 5B, mitochondrial
2	9597.XP_003807873.1	0.999	Cytochrome b-c1 complex subunit 2, mitochondrial
3	9597.XP_003812052.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 319 ESTs, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
4	9597.XP_003819481.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 694 ESTs, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
5	9597.XP_003821726.1	0.999	Cytochrome b-c1 complex subunit 7
6	9597.XP_003829342.1	0.999	Cytochrome b-c1 complex subunit 8
7	9597.XP_008969959.1	0.999	Cytochrome b-c1 complex subunit 1, mitochondrial
8	9597.XP_008972004.1	0.999	NADH:ubiquinone oxidoreductase subunit A9
9	9597.XP_003811885.1	0.998	NADH:ubiquinone oxidoreductase core subunit S2
10	9597.XP_003815222.1	0.998	NADH:ubiquinone oxidoreductase core subunit S3
11	9597.XP_003815494.1	0.998	NADH:ubiquinone oxidoreductase subunit A5
12	9597.XP_003827402.1	0.998	NADH:ubiquinone oxidoreductase subunit S4
13	9597.XP_003828782.1	0.998	NADH:ubiquinone oxidoreductase core subunit V1
14	9597.XP_003833164.1	0.998	NADH:ubiquinone oxidoreductase subunit A8
15	9597.XP_008964832.1	0.998	NADH:ubiquinone oxidoreductase core subunit S7
16	9597.XP_008972488.1	0.998	Belongs to the complex I 75 kDa subunit family.
17	9597.XP_003816209.1	0.997	Belongs to the cytochrome c oxidase subunit 6B.
18	9597.XP_003822837.1	0.997	Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol- cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c ox [...]
19	9597.XP_003807126.1	0.996	NADH:ubiquinone oxidoreductase subunit B7
20	9597.XP_003812798.1	0.996	Cytochrome b-c1 complex subunit 6, mitochondrial isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0003824	0.994	catalytic activity
GO:0016491	0.967	oxidoreductase activity
GO:0009055	0.936	electron transfer activity
GO:0022804	0.922	active transmembrane transporter activity
GO:0015399	0.883	primary active transmembrane transporter activity
GO:0015078	0.881	proton transmembrane transporter activity
GO:0015453	0.871	oxidoreduction-driven active transmembrane transporter activity
GO:0008121	0.861	ubiquinol-cytochrome-c reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.985	cellular metabolic process
GO:0006091	0.880	generation of precursor metabolites and energy
GO:0007005	0.825	mitochondrion organization
GO:0045333	0.810	cellular respiration
GO:0044085	0.599	cellular component biogenesis
GO:0043933	0.452	protein-containing complex organization
GO:0022607	0.420	cellular component assembly
GO:0022904	0.354	respiratory electron transport chain
GO:0065003	0.350	protein-containing complex assembly
GO:0033108	0.335	mitochondrial respiratory chain complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	1.000	mitochondrial inner membrane
GO:0032991	0.999	protein-containing complex
GO:1990204	0.986	oxidoreductase complex
GO:1902495	0.986	transmembrane transporter complex
GO:0098803	0.986	respiratory chain complex
GO:0098800	0.985	inner mitochondrial membrane protein complex
GO:0005746	0.982	mitochondrial respirasome
GO:0070069	0.919	cytochrome complex
GO:0045275	0.863	respiratory chain complex III
GO:0005750	0.828	mitochondrial respiratory chain complex III
GO:0070013	0.434	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.967	Oxidoreductases.
EC:7.-.-.-	0.883	Translocases.
RHEA:11484	0.861	a quinol + 2 Fe(III)-[cytochrome c](out) = a quinone + 2 Fe(II)-[cytochrome c](out) + 2 H(+)(out)
EC:7.1.1.8	0.861	quinol--cytochrome-c reductase.

[back to server]