StarFunc result for job id P0C7T5

User Input

>input (689 residues)
MKPVHERSQECLPPKKRDLPVTSEDMGRTTSCSTNHTPSSDASEWSRGVVVAGQSQAGAR
VSLGGDGAEAITGLTVDQYGMLYKVAVPPATFSPTGLPSVVNMSPLPPTFNVASSLIQHP
GIHYPPLHYAQLPSTSLQFIGSPYSLPYAVPPNFLPSPLLSPSANLATSHLPHFVPYASL
LAEGATPPPQAPSPAHSFNKAPSATSPSGQLPHHSSTQPLDLAPGRMPIYYQMSRLPAGY
TLHETPPAGASPVLTPQESQSALEAAAANGGQRPRERNLVRRESEALDSPNSKGEGQGLV
PVVECVVDGQLFSGSQTPRVEVAAPAHRGTPDTDLEVQRVVGALASQDYRVVAAQRKEEP
SPLNLSHHTPDHQGEGRGSARNPAELAEKSQARGFYPQSHQEPVKHRPLPKAMVVANGNL
VPTGTDSGLLPVGSEILVASSLDVQARATFPDKEPTPPPITSSHLPSHFMKGAIIQLATG
ELKRVEDLQTQDFVRSAEVSGGLKIDSSTVVDIQESQWPGFVMLHFVVGEQQSKVSIEVP
PEHPFFVYGQGWSSCSPGRTTQLFSLPCHRLQVGDVCISISLQSLNSNSVSQASCAPPSQ
LGPPRERPERTVLGSRELCDSEGKSQPAGEGSRVVEPSQPESGAQACWPAPSFQRYSMQG
EEARAALLRPSFIPQEVKLSIEGRSNAGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C7T5	0.999	0.999	8.690E-100	689	1.000	1.000	P0C7T5.pdb.gz	ATX1L_HUMAN Ataxin-1-like OS=Homo sapiens OX=9606 GN=ATXN1L PE=1 SV=1
2	AFDB:E7FB74	0.239	0.220	4.148E-39	765	0.425	0.383	E7FB74.pdb.gz	E7FB74_DANRE Ataxin-1-like OS=Danio rerio OX=7955 GN=atxn1l PE=3 SV=2
3	AFDB:A2ABF9	0.048	0.032	3.212E-3	1267	0.183	0.099	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
4	AFDB:P38800	0.057	0.037	5.869E-3	1345	0.141	0.072	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
5	AFDB:Q583D5	0.052	0.037	1.072E-2	1170	0.154	0.091	Q583D5.pdb.gz	Q583D5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.950 PE=4 SV=1
6	AFDB:A0A0G2K889	0.055	0.038	2.494E-2	1289	0.144	0.077	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
7	AFDB:Q91YE5	0.062	0.031	3.174E-2	1889	0.148	0.054	Q91YE5.pdb.gz	BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus OX=10090 GN=Baz2a PE=1 SV=2
8	AFDB:Q9H9B1	0.068	0.043	4.839E-2	1298	0.155	0.082	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4
9	AFDB:Q5D869	0.062	0.035	7.380E-2	1976	0.136	0.048	Q5D869.pdb.gz	NRPE1_ARATH DNA-directed RNA polymerase V subunit 1 OS=Arabidopsis thaliana OX=3702 GN=NRPE1 PE=1 SV=1
10	PDB:7krjC	0.052	0.186	7.383E-2	133	0.012	0.060	7krjC.pdb.gz	Structure of Hsp90-p23-GR reveals the Hsp90 client-remodelling mechanism.
11	PDB:1b9mA	0.061	0.149	8.846E-2	258	0.022	0.058	1b9mA.pdb.gz
12	PDB:7a1gh	0.047	0.389	1.196E-1	63	0.009	0.095	7a1gh.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
13	AFDB:O15117	0.064	0.058	1.348E-1	783	0.149	0.132	O15117.pdb.gz	FYB1_HUMAN FYN-binding protein 1 OS=Homo sapiens OX=9606 GN=FYB1 PE=1 SV=2
14	PDB:2waqG	0.052	0.232	2.185E-1	113	0.020	0.124	2waqG.pdb.gz	Evolution of complex RNA polymerases: the complete archaeal RNA polymerase structure.
15	PDB:4v6wAc	0.059	0.462	2.953E-1	62	0.007	0.081	4v6wAc.pdb.gz	Structures of the human and Drosophila 80S ribosome.
16	PDB:3j79D	0.055	0.127	3.137E-1	247	0.017	0.049	3j79D.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
17	PDB:2kmwA	0.053	0.175	3.538E-1	150	0.023	0.107	2kmwA.pdb.gz
18	PDB:2i0qA	0.050	0.072	3.758E-1	461	0.004	0.007	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
19	PDB:6htsD	0.065	0.096	4.240E-1	434	0.016	0.025	6htsD.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
20	PDB:1bbuA	0.071	0.096	4.783E-1	486	0.007	0.010	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C7T5	0.0	1390	689	1.000	1.000	ATX1L_HUMAN Ataxin-1-like OS=Homo sapiens OX=9606 GN=ATXN1L PE=1 SV=1
2	P0C7T6	0.0	1297	687	0.936	0.939	ATX1L_MOUSE Ataxin-1-like OS=Mus musculus OX=10090 GN=Atxn1l PE=1 SV=1
3	E7FB74	8.35e-123	385	765	0.463	0.417	E7FB74_DANRE Ataxin-1-like OS=Danio rerio OX=7955 GN=atxn1l PE=3 SV=2
4	P54254	5.45e-60	218	791	0.174	0.152	ATX1_MOUSE Ataxin-1 OS=Mus musculus OX=10090 GN=Atxn1 PE=1 SV=2
5	P54253	5.11e-57	209	815	0.157	0.133	ATX1_HUMAN Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=2
6	Q1L966	6.27e-55	203	781	0.168	0.149	Q1L966_DANRE Ataxin 1a OS=Danio rerio OX=7955 GN=atxn1b PE=2 SV=1
7	E7F6Z5	1.46e-46	179	827	0.192	0.160	E7F6Z5_DANRE Ataxin 1b OS=Danio rerio OX=7955 GN=atxn1b PE=3 SV=1
8	Q9W3V7	2.69e-28	115	230	0.075	0.226	Q9W3V7_DROME Ataxin 1 OS=Drosophila melanogaster OX=7227 GN=Atx-1 PE=2 SV=1
9	H7C4S2	2.56e-05	49.7	454	0.046	0.070	H7C4S2_HUMAN HMG-box transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=HBP1 PE=1 SV=1
10	Q62661	3.18e-05	49.3	513	0.054	0.072	HBP1_RAT HMG box-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Hbp1 PE=1 SV=2
11	O60381	3.44e-05	49.3	514	0.046	0.062	HBP1_HUMAN HMG box-containing protein 1 OS=Homo sapiens OX=9606 GN=HBP1 PE=1 SV=2
12	Q8R316	5.35e-05	48.9	516	0.046	0.062	HBP1_MOUSE HMG box-containing protein 1 OS=Mus musculus OX=10090 GN=Hbp1 PE=1 SV=1
13	Q38A19	1.4	34.3	334	0.022	0.045	Q38A19_TRYB2 Oxidoreductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0820 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12547 ATXN-1_C	2.2e-16	71.7	Ataxin-1 like family
2	PF08517 AXH	5.4e-36	134.9	Ataxin-1 and HBP1 module (AXH)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415822

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244769	0.905	Ataxin-1
2	9606.ENSP00000345206	0.899	Recombining binding protein suppressor of hairless
3	9606.ENSP00000340330	0.892	Histone acetyltransferase KAT5
4	9606.ENSP00000388638	0.867	Splicing factor 45
5	9606.ENSP00000338173	0.806	Pumilio homolog 2
6	9606.ENSP00000341243	0.802	Recombining binding protein suppressor of hairless-like protein
7	9606.ENSP00000327509	0.741	SH3 and cysteine rich domain 2
8	9606.ENSP00000247665	0.736	14 kDa phosphohistidine phosphatase
9	9606.ENSP00000458663	0.712	Protein capicua homolog
10	9606.ENSP00000354085	0.670	Ankyrin repeat and KH domain-containing protein 1
11	9606.ENSP00000384018	0.636	Nuclear receptor corepressor 2
12	9606.ENSP00000218224	0.633	Polyglutamine-binding protein 1
13	9606.ENSP00000266068	0.592	Glucocorticoid modulatory element-binding protein 2
14	9606.ENSP00000310585	0.577	Purkinje cell protein 2 homolog
15	9606.ENSP00000417864	0.564	Acidic leucine-rich nuclear phosphoprotein 32 family member A
16	9606.ENSP00000454852	0.551	Snurportin-1
17	9606.ENSP00000432016	0.542	ANKHD1-EIF4EBP3 readthrough
18	9606.ENSP00000266594	0.514	Acidic nuclear phosphoprotein 32 family member D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.988	regulation of primary metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0009987	0.984	cellular process
GO:0051253	0.983	negative regulation of RNA metabolic process
GO:2001141	0.981	regulation of RNA biosynthetic process
GO:0010468	0.980	regulation of gene expression
GO:0010558	0.977	negative regulation of macromolecule biosynthetic process
GO:1901360	0.965	organic cyclic compound metabolic process
GO:0043170	0.965	macromolecule metabolic process
GO:0046483	0.965	heterocycle metabolic process
GO:0006725	0.965	cellular aromatic compound metabolic process
GO:0090304	0.963	nucleic acid metabolic process
GO:0006357	0.958	regulation of transcription by RNA polymerase II
GO:0045892	0.958	negative regulation of DNA-templated transcription
GO:0010467	0.956	gene expression
GO:0016070	0.948	RNA metabolic process
GO:0006366	0.915	transcription by RNA polymerase II
GO:0060541	0.867	respiratory system development
GO:0030324	0.864	lung development
GO:0048518	0.861	positive regulation of biological process
GO:0048522	0.837	positive regulation of cellular process
GO:0048286	0.837	lung alveolus development
GO:0000122	0.613	negative regulation of transcription by RNA polymerase II
GO:0035176	0.415	social behavior
GO:0071840	0.409	cellular component organization or biogenesis
GO:0016043	0.400	cellular component organization
GO:0050896	0.316	response to stimulus
GO:0050890	0.311	cognition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005730	0.939	nucleolus
GO:0005737	0.933	cytoplasm
GO:0005829	0.444	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]