StarFunc result for job id P0C7V0

User Input

>input (271 residues)
MLNSPGTRRPVKEAQKYGEDSQKSHSPGTPGPRSSVTTLSASALSDSSSPDTPPRRGPGR
PSTPARAPATSAPMMYSRRGVRRTARPAGADTRSSANQLPQPSGACANADSAPPADVSAC
LRRRSHGDRCVPRSRRRPRPRPRASTAFFQEEGPCGACPGALRPQAGASFRELRGLPPPR
PREREQSPPLGAAPSSALSHQGWKNTRCATRGLVNTLVNTGHFLYLQPPAPLIMPYLDDA
EVPGNRRSHPSLSFSWLSKALYHVTFLLRIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P60410	0.092	0.095	3.106E-1	259	0.140	0.147	P60410.pdb.gz	KR108_HUMAN Keratin-associated protein 10-8 OS=Homo sapiens OX=9606 GN=KRTAP10-8 PE=1 SV=2
2	AFDB:Q5BHZ4	0.102	0.096	4.958E-1	290	0.173	0.162	Q5BHZ4.pdb.gz	Q5BHZ4_DROME GM06171p (Fragment) OS=Drosophila melanogaster OX=7227 GN=RpL23A PE=2 SV=1
3	AFDB:Q38A03	0.092	0.080	6.058E-1	333	0.188	0.153	Q38A03.pdb.gz	Q38A03_TRYB2 T. brucei spp.-specific protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0600 PE=4 SV=1
4	AFDB:Q6PI77	0.102	0.061	6.058E-1	547	0.151	0.075	Q6PI77.pdb.gz	GASP3_HUMAN G protein-coupled receptor associated sorting protein 3 OS=Homo sapiens OX=9606 GN=GPRASP3 PE=1 SV=1
5	AFDB:Q02796	0.115	0.097	9.047E-1	332	0.162	0.133	Q02796.pdb.gz	LGE1_YEAST Transcriptional regulatory protein LGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LGE1 PE=1 SV=1
6	AFDB:Q80VH0	0.084	0.037	9.047E-1	783	0.159	0.055	Q80VH0.pdb.gz	BANK1_MOUSE B-cell scaffold protein with ankyrin repeats OS=Mus musculus OX=10090 GN=Bank1 PE=1 SV=3
7	AFDB:Q8IJ54	0.093	0.073	1.034	371	0.092	0.067	Q8IJ54.pdb.gz	Q8IJ54_PLAF7 Merozoite surface protein 6 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1035500 PE=4 SV=1
8	AFDB:B0S6R3	0.100	0.066	1.887	530	0.144	0.074	B0S6R3.pdb.gz
9	AFDB:Q04930	0.118	0.076	1.887	467	0.129	0.075	Q04930.pdb.gz	CRF1_YEAST Transcription factor CRF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRF1 PE=1 SV=1
10	AFDB:X2JGQ0	0.112	0.052	2.157	755	0.133	0.048	X2JGQ0.pdb.gz	X2JGQ0_DROME PH-sensitive chloride channel 1, isoform U OS=Drosophila melanogaster OX=7227 GN=pHCl-1 PE=4 SV=2
11	PDB:6jxrm	0.084	0.089	9.494	248	0.037	0.040	6jxrm.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q90748	0.021	38.5	1099	0.144	0.035	Q90748_CHICK Brush border myosin IB OS=Gallus gallus OX=9031 GN=CBBMIB PE=2 SV=1
2	P70248	0.048	37.7	1099	0.129	0.032	MYO1F_MOUSE Unconventional myosin-If OS=Mus musculus OX=10090 GN=Myo1f PE=1 SV=1
3	A2ASS6	0.10	36.6	35213	0.170	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
4	P30622	0.15	36.2	1438	0.077	0.015	CLIP1_HUMAN CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1 PE=1 SV=2
5	Q10L71	0.22	35.4	966	0.133	0.037	VLN2_ORYSJ Villin-2 OS=Oryza sativa subsp. japonica OX=39947 GN=VLN2 PE=2 SV=1
6	B7YZG4	0.30	35.0	5368	0.137	0.007	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
7	A0A0B4K7P8	0.36	35.0	5394	0.137	0.007	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
8	A0A0B4K7Y9	0.38	34.7	5408	0.137	0.007	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
9	B7YZG6	0.38	34.7	5479	0.137	0.007	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
10	E1JH62	0.38	34.7	5388	0.137	0.007	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	E1JH63	0.42	34.7	5499	0.137	0.007	E1JH63_DROME Short stop, isoform O OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
12	A0A0B4K718	0.48	34.7	4100	0.137	0.009	A0A0B4K718_DROME Short stop, isoform AB OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	A0A0B4K869	0.48	34.7	5434	0.137	0.007	A0A0B4K869_DROME Short stop, isoform AD OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	Q7TSY8	0.81	33.5	1164	0.085	0.020	SGO2_MOUSE Shugoshin 2 OS=Mus musculus OX=10090 GN=Sgo2 PE=1 SV=1
15	Q8JSZ3	0.93	33.5	1684	0.089	0.014	GP_CCHFI Envelopment polyprotein OS=Crimean-Congo hemorrhagic fever virus (strain Nigeria/IbAr10200/1970) OX=652961 GN=GP PE=1 SV=1
16	G3V6S0	2.1	32.3	2361	0.107	0.012	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
17	Q6XD99	2.1	32.3	2358	0.107	0.012	Q6XD99_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=2 SV=1
18	Q62261	3.8	31.6	2363	0.107	0.012	SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptbn1 PE=1 SV=2
19	Q1XG44	6.3	30.8	2932	0.059	0.005	Q1XG44_XENLA Nipped-B protein OS=Xenopus laevis OX=8355 GN=nipbl.S PE=2 SV=1
20	O75962	6.9	30.8	3097	0.096	0.008	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 546270.GEMHA0001_0073

Rank	PPI partner	STRING score	Description
1	546270.GEMHA0001_0852	0.967	One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex.
2	546270.GEMHA0001_0855	0.967	Binds to the 23S rRNA
3	546270.GEMHA0001_0868	0.967	Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation
4	546270.GEMHA0001_0874	0.967	One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit
5	546270.GEMHA0001_1745	0.963	Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release.
6	546270.GEMHA0001_0872	0.961	One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome
7	546270.GEMHA0001_0570	0.957	Specifically methylates the cytosine at position 967 (m5C967) of 16S rRNA
8	546270.GEMHA0001_1744	0.957	Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Rule:MF_00736, ECO:0000256\|RuleBase:RU003979,
9	546270.GEMHA0001_0857	0.954	Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body.
10	546270.GEMHA0001_0850	0.953	Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits
11	546270.GEMHA0001_0860	0.952	One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit
12	546270.GEMHA0001_0870	0.952	Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA
13	546270.GEMHA0001_0869	0.951	The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wall of the exit tunnel in the center of the 70S ribosome
14	546270.GEMHA0001_0871	0.951	One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity
15	546270.GEMHA0001_1270	0.951	Selenocysteine-specific translation elongation factor
16	546270.GEMHA0001_1620	0.951	One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA
17	546270.GEMHA0001_0873	0.949	Forms part of the polypeptide exit tunnel.
18	546270.GEMHA0001_1669	0.949	Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharged (Met-Ala-, Cys, Gly, Pro, Ser, Thr, or Val). Requires deformylation of the N(alpha)-formylated initiator methionine before it can be hydrolyzed
19	546270.GEMHA0001_0330	0.946	Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome
20	546270.GEMHA0001_0875	0.946	Involved in the binding of tRNA to the ribosomes.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.402	developmental process
GO:0065007	0.318	biological regulation
GO:0050789	0.305	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.995	intracellular organelle
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0005634	0.767	nucleus
GO:0005737	0.735	cytoplasm
GO:0070013	0.438	intracellular organelle lumen
GO:0031981	0.418	nuclear lumen
GO:0005739	0.380	mitochondrion
GO:0005654	0.367	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]