StarFunc result for job id P0C7V4

User Input

>input (464 residues)
MMARRDPTSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCP
MKCWKAALVPATLGKKEGKENLKPWKPRVEANPGPLNKDKGEKEERPRQQDPQRKALLHM
FSGKPPEKPLPNGKGSTEPSDYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVL
ASLSPLRKASLSSSSSLGPKERQTGAAADMPQPAVRHQGREPLLVVKPTHSRPEGGCREV
PQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA
CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVD
RQPPHSRPCLPTAQACTMSHHPAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.244	0.244	4.655E-57	464	0.927	0.927	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:M9PGE2	0.060	0.027	4.688E-2	1257	0.157	0.058	M9PGE2.pdb.gz	M9PGE2_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
3	AFDB:Q6FUW3	0.063	0.035	1.478E-1	975	0.140	0.067	Q6FUW3.pdb.gz	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1
4	AFDB:Q9QX47	0.064	0.017	2.904E-1	2444	0.157	0.030	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
5	AFDB:H3BJD0	0.078	0.046	4.660E-1	977	0.162	0.077	H3BJD0.pdb.gz	H3BJD0_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
6	AFDB:Q9QWH1	0.063	0.042	4.660E-1	850	0.181	0.099	Q9QWH1.pdb.gz	PHC2_MOUSE Polyhomeotic-like protein 2 OS=Mus musculus OX=10090 GN=Phc2 PE=1 SV=1
7	AFDB:Q9NRM1	0.070	0.039	5.334E-1	1142	0.157	0.064	Q9NRM1.pdb.gz	ENAM_HUMAN Enamelin OS=Homo sapiens OX=9606 GN=ENAM PE=1 SV=3
8	AFDB:Q8N1G0	0.070	0.037	1.121	1237	0.151	0.057	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
9	AFDB:Q9VPZ7	0.068	0.030	1.284	1342	0.155	0.054	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
10	AFDB:Q54WA7	0.078	0.049	1.373	785	0.134	0.079	Q54WA7.pdb.gz	Q54WA7_DICDI RNA binding protein OS=Dictyostelium discoideum OX=44689 GN=pufA PE=4 SV=1
11	PDB:6edtJ	0.066	0.222	1.716	109	0.028	0.119	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
12	PDB:7y9tA	0.052	0.063	2.101	380	0.015	0.018	7y9tA.pdb.gz
13	PDB:5hutA	0.040	0.040	2.573	469	0.013	0.013	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
14	PDB:3sucA	0.044	0.028	2.753	767	0.013	0.008	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
15	PDB:4v8mBj	0.054	0.145	3.151	161	0.015	0.043	4v8mBj.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
16	PDB:3zqjF	0.046	0.036	3.372	607	0.013	0.010	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
17	PDB:1jkiA	0.044	0.039	3.607	525	0.004	0.004	1jkiA.pdb.gz	The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase
18	PDB:1p1fA	0.044	0.041	3.607	501	0.004	0.004	1p1fA.pdb.gz
19	PDB:7mq8L8	0.038	0.097	3.607	180	0.013	0.033	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:1jkfA	0.044	0.044	3.859	466	0.004	0.004	1jkfA.pdb.gz	The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	811	464	0.927	0.927	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	P03347	0.12	37.4	512	0.034	0.031	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
3	P04591	0.12	37.4	500	0.034	0.032	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
4	Q77YG1	0.12	37.4	500	0.034	0.032	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
5	P04590	0.22	36.6	522	0.080	0.071	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
6	P03348	0.43	35.4	512	0.032	0.029	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
7	P04585	0.51	35.4	1435	0.034	0.011	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
8	P03366	0.55	35.4	1447	0.034	0.011	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
9	P05888	0.91	34.3	507	0.030	0.028	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
10	Q72497	1.1	34.3	500	0.030	0.028	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
11	Q79791	1.1	34.3	500	0.030	0.028	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
12	Q8IZX4	2.3	33.5	1826	0.082	0.021	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1
13	G5EF97	3.1	32.7	699	0.022	0.014	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1
14	Q18859	3.8	32.7	1246	0.058	0.022	Q18859_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ifta-1 PE=4 SV=4
15	P12497	4.8	32.3	1435	0.060	0.020	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
16	Q92830	5.0	32.3	837	0.052	0.029	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
17	D4ACX5	5.1	32.3	833	0.052	0.029	D4ACX5_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2a PE=3 SV=3
18	Q9JHD2	5.3	32.0	830	0.052	0.029	KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2
19	P35963	5.7	32.0	1435	0.030	0.010	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
20	Q80UV9	9.4	31.6	1891	0.024	0.006	TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus OX=10090 GN=Taf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14803 Nudix_N_2	5.1e+02	12.0	Nudix N-terminal
2	PF00098 zf-CCHC	1.1e+02	14.4	Zinc knuckle
3	PF15288 zf-CCHC_6	3.5e-19	79.7	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.416	catalytic activity
GO:0016740	0.358	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0019222	0.967	regulation of metabolic process
GO:0048518	0.933	positive regulation of biological process
GO:0048522	0.924	positive regulation of cellular process
GO:0031323	0.912	regulation of cellular metabolic process
GO:0043170	0.887	macromolecule metabolic process
GO:0009893	0.876	positive regulation of metabolic process
GO:0060255	0.857	regulation of macromolecule metabolic process
GO:0019219	0.856	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.778	regulation of RNA metabolic process
GO:0031325	0.774	positive regulation of cellular metabolic process
GO:0010468	0.744	regulation of gene expression
GO:0031326	0.729	regulation of cellular biosynthetic process
GO:0010556	0.726	regulation of macromolecule biosynthetic process
GO:0010604	0.725	positive regulation of macromolecule metabolic process
GO:0006355	0.708	regulation of DNA-templated transcription
GO:0051173	0.698	positive regulation of nitrogen compound metabolic process
GO:0045935	0.638	positive regulation of nucleobase-containing compound metabolic process
GO:0044260	0.584	cellular macromolecule metabolic process
GO:1903508	0.475	positive regulation of nucleic acid-templated transcription
GO:0019538	0.466	protein metabolic process
GO:0043412	0.459	macromolecule modification
GO:0045893	0.444	positive regulation of DNA-templated transcription
GO:0034641	0.410	cellular nitrogen compound metabolic process
GO:0006139	0.398	nucleobase-containing compound metabolic process
GO:0090304	0.379	nucleic acid metabolic process
GO:0036211	0.347	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0070013	0.992	intracellular organelle lumen
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0005654	0.973	nucleoplasm
GO:0005694	0.959	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.358	Transferases.

[back to server]