StarFunc result for job id P0C7W6

User Input

>input (258 residues)
MSLESLFQHIIFTEHQAEESRRLMREVRSEITRCREKIKKATEELNEEKIKLESKVQQFF
EKSFFLQLLKAHENALEKQYSEITNHRNMLLQTFEAIKKQMIEEEDKFIKEITDFNNDYE
ITKKRELLMKENVKIEISDLENQANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQR
KLKVFEDEENESICTTKYLEAEKIKISEKPQNDTECLRLKKELELYKEDDMESVYEALQT
EIEFLELTLAQKDLQESK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C7W6	1.000	1.000	3.620E-32	258	1.000	1.000	P0C7W6.pdb.gz	CC172_HUMAN Coiled-coil domain-containing protein 172 OS=Homo sapiens OX=9606 GN=CCDC172 PE=1 SV=1
2	AFDB:Q6AXT4	0.626	0.614	6.861E-22	263	0.705	0.692	Q6AXT4.pdb.gz	CC172_RAT Coiled-coil domain-containing protein 172 OS=Rattus norvegicus OX=10116 GN=Ccdc172 PE=1 SV=1
3	AFDB:Q810N9	0.669	0.650	9.488E-22	267	0.682	0.659	Q810N9.pdb.gz	CC172_MOUSE Coiled-coil domain-containing protein 172 OS=Mus musculus OX=10090 GN=Ccdc172 PE=1 SV=1
4	AFDB:Q06629	0.267	0.111	2.384	674	0.178	0.068	Q06629.pdb.gz	HDA2_YEAST HDA1 complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HDA2 PE=1 SV=1
5	AFDB:G3V9H6	0.411	0.137	8.041	876	0.194	0.057	G3V9H6.pdb.gz	G3V9H6_RAT PPFIA binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ppfibp2 PE=1 SV=2
6	AFDB:Q60974	0.193	0.027	9.456	2453	0.066	0.007	Q60974.pdb.gz	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C7W6	0.0	498	258	1.000	1.000	CC172_HUMAN Coiled-coil domain-containing protein 172 OS=Homo sapiens OX=9606 GN=CCDC172 PE=1 SV=1
2	Q810N9	2.25e-125	358	267	0.702	0.678	CC172_MOUSE Coiled-coil domain-containing protein 172 OS=Mus musculus OX=10090 GN=Ccdc172 PE=1 SV=1
3	Q6AXT4	3.61e-125	358	263	0.717	0.703	CC172_RAT Coiled-coil domain-containing protein 172 OS=Rattus norvegicus OX=10116 GN=Ccdc172 PE=1 SV=1
4	Q9UBC2	0.003	41.2	864	0.155	0.046	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
5	Q60902	0.046	37.4	907	0.167	0.047	EP15R_MOUSE Epidermal growth factor receptor substrate 15-like 1 OS=Mus musculus OX=10090 GN=Eps15l1 PE=1 SV=3
6	Q8MMD2	0.048	37.4	1232	0.140	0.029	Q8MMD2_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform B OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
7	Q2Q1W5	0.050	37.4	3664	0.155	0.011	Q2Q1W5_DANRE Laminin alpha 5 OS=Danio rerio OX=7955 GN=wu:fb81a10 PE=1 SV=1
8	A0A0C4DG40	0.071	37.0	8749	0.159	0.005	A0A0C4DG40_HUMAN Spectrin repeat containing nuclear envelope protein 1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=1
9	Q8NF91	0.074	37.0	8797	0.159	0.005	SYNE1_HUMAN Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4
10	P07942	0.090	36.6	1786	0.116	0.017	LAMB1_HUMAN Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2
11	E3CTP7	0.15	35.8	792	0.140	0.045	E3CTP7_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform D OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
12	Q8MMD3	0.18	35.4	1106	0.140	0.033	Q8MMD3_DROME Epidermal growth factor receptor pathway substrate clone 15, isoform C OS=Drosophila melanogaster OX=7227 GN=Eps-15 PE=1 SV=1
13	Q960M7	0.80	33.5	931	0.147	0.041	Q960M7_DROME LD44526p OS=Drosophila melanogaster OX=7227 GN=corn PE=2 SV=1
14	M9PHM1	0.82	33.5	1101	0.147	0.035	M9PHM1_DROME Cornetto, isoform D OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=1
15	Q8IQ73	0.82	33.5	1107	0.147	0.034	Q8IQ73_DROME Cornetto, isoform C OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=2
16	M9PBT2	1.3	32.7	970	0.147	0.039	M9PBT2_DROME Cornetto, isoform E OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=1
17	Q967H1	1.3	32.7	960	0.147	0.040	Q967H1_DROME Cornetto OS=Drosophila melanogaster OX=7227 GN=corn PE=2 SV=1
18	Q9VS25	1.3	32.7	960	0.147	0.040	Q9VS25_DROME Cornetto, isoform B OS=Drosophila melanogaster OX=7227 GN=corn PE=4 SV=2
19	A0A8I5ZQX0	2.6	32.0	1065	0.194	0.047	A0A8I5ZQX0_RAT RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1
20	A0A8I5ZUA1	2.6	32.0	1053	0.194	0.047	A0A8I5ZUA1_RAT RAB11 family interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Rab11fip3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07716 bZIP_2	1.5e+02	13.8	Basic region leucine zipper
2	PF04632 FUSC	4e+02	11.0	Fusaric acid resistance protein family
3	PF13851 GAS	3.7	18.4	Growth-arrest specific micro-tubule binding
4	PF18833 TPR_22	1.2e+02	14.4	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329860

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363226	0.730	Chromosome 10 open reading frame 53
2	9606.ENSP00000309285	0.653	Coiled-coil domain containing 96
3	9606.ENSP00000207457	0.642	Tektin-2
4	9606.ENSP00000283025	0.642	Tektin-5
5	9606.ENSP00000382646	0.604	Protein FAM166B
6	9606.ENSP00000377690	0.601	Participates positively in the ciliary Hedgehog (Hh) signaling
7	9606.ENSP00000379263	0.553	Tektin-3
8	9606.ENSP00000341346	0.538	Tektin-1
9	9606.ENSP00000414635	0.529	Leucine-rich repeat-containing protein 34
10	9606.ENSP00000316681	0.505	Centrosomal protein of 295 kDa
11	9606.ENSP00000335094	0.502	Transmembrane protein 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016043	0.988	cellular component organization
GO:0006996	0.916	organelle organization
GO:0065007	0.869	biological regulation
GO:0050789	0.804	regulation of biological process
GO:0050794	0.610	regulation of cellular process
GO:0007059	0.532	chromosome segregation
GO:0022414	0.507	reproductive process
GO:0061982	0.331	meiosis I cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0043227	0.982	membrane-bounded organelle
GO:0043231	0.930	intracellular membrane-bounded organelle
GO:0005737	0.928	cytoplasm
GO:0005929	0.857	cilium
GO:0005634	0.842	nucleus
GO:0031514	0.573	motile cilium
GO:0005829	0.536	cytosol
GO:0036126	0.505	sperm flagellum
GO:0043233	0.396	organelle lumen
GO:0015630	0.395	microtubule cytoskeleton
GO:0070013	0.385	intracellular organelle lumen
GO:0031981	0.380	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]