StarFunc result for job id P0C7W9

User Input

>input (464 residues)
MMARRDPTSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCP
MKCWKAALVPATLGKKEGKENLKPWKPRVEANPGPLNKDKGEKEERPRQQDPQRKALLHM
FSGKPPEKPLPNGKGSTEPSDYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVL
ASLSPLRKASLSSSSSLGPKERQTGAAADMPQPAVRHQGREPLLVVKPTHSRPEGDCREV
PQAASKTHGLLQAARPQAQDKRPAVTSQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA
CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVD
RQPPHSRPCLPTAQACTMSHHPAASHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.229	0.229	6.405E-58	464	0.925	0.925	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:H3BKE7	0.067	0.059	1.118E-1	533	0.166	0.144	H3BKE7.pdb.gz	H3BKE7_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
3	AFDB:H3BJD0	0.061	0.033	5.295E-1	977	0.147	0.070	H3BJD0.pdb.gz	H3BJD0_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
4	AFDB:Q0WQM3	0.058	0.039	6.486E-1	797	0.226	0.132	Q0WQM3.pdb.gz	Q0WQM3_ARATH Chaperone DnaJ-domain superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SDJ3 PE=1 SV=1
5	AFDB:M9PGE2	0.088	0.041	7.426E-1	1257	0.168	0.062	M9PGE2.pdb.gz	M9PGE2_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
6	AFDB:F1LP90	0.066	0.026	9.732E-1	1336	0.205	0.071	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
7	AFDB:Q8SWR8	0.062	0.031	1.275	1084	0.164	0.070	Q8SWR8.pdb.gz	ATX2_DROME Ataxin-2 homolog OS=Drosophila melanogaster OX=7227 GN=Atx2 PE=1 SV=1
8	AFDB:F4JLV7	0.069	0.063	1.460	530	0.185	0.162	F4JLV7.pdb.gz	F4JLV7_ARATH Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g22505 PE=1 SV=1
9	AFDB:P06401	0.062	0.037	1.460	933	0.200	0.100	P06401.pdb.gz	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
10	AFDB:Q9VPZ7	0.058	0.026	1.460	1342	0.175	0.060	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
11	PDB:6edtJ	0.064	0.200	1.954	109	0.019	0.083	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
12	PDB:7y9tA	0.052	0.063	2.091	380	0.015	0.018	7y9tA.pdb.gz
13	PDB:5hutA	0.032	0.032	2.394	469	0.013	0.013	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
14	PDB:3sucA	0.045	0.028	2.561	767	0.015	0.009	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
15	PDB:1jkfA	0.044	0.044	3.357	466	0.004	0.004	1jkfA.pdb.gz	The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase
16	PDB:6i9ra	0.053	0.224	3.357	83	0.017	0.096	6i9ra.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
17	PDB:3zqjF	0.046	0.036	3.843	607	0.013	0.010	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
18	PDB:7mq8L8	0.038	0.097	3.843	180	0.009	0.022	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:1p1fA	0.044	0.041	4.112	501	0.004	0.004	1p1fA.pdb.gz
20	PDB:1jkiA	0.044	0.039	4.708	525	0.004	0.004	1jkiA.pdb.gz	The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	808	464	0.925	0.925	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	P03347	0.12	37.4	512	0.034	0.031	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
3	P04591	0.12	37.4	500	0.034	0.032	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
4	Q77YG1	0.12	37.4	500	0.034	0.032	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
5	P04590	0.22	36.6	522	0.080	0.071	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
6	P03348	0.42	35.4	512	0.032	0.029	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
7	P04585	0.51	35.4	1435	0.034	0.011	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
8	P03366	0.55	35.4	1447	0.034	0.011	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
9	P05888	0.90	34.3	507	0.030	0.028	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
10	Q72497	1.1	34.3	500	0.030	0.028	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
11	Q79791	1.1	34.3	500	0.030	0.028	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
12	Q8IZX4	2.2	33.5	1826	0.082	0.021	TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens OX=9606 GN=TAF1L PE=1 SV=1
13	G5EF97	3.2	32.7	699	0.022	0.014	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1
14	Q18859	4.1	32.7	1246	0.058	0.022	Q18859_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ifta-1 PE=4 SV=4
15	P12497	4.8	32.3	1435	0.060	0.020	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
16	Q92830	5.0	32.3	837	0.052	0.029	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
17	D4ACX5	5.4	32.0	833	0.052	0.029	D4ACX5_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2a PE=3 SV=3
18	Q9JHD2	5.5	32.0	830	0.052	0.029	KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2
19	P35963	5.7	32.0	1435	0.030	0.010	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
20	A0A8I6A7M0	9.1	31.6	1893	0.024	0.006	A0A8I6A7M0_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14803 Nudix_N_2	6.6e+02	11.7	Nudix N-terminal
2	PF00098 zf-CCHC	1e+02	14.4	Zinc knuckle
3	PF15288 zf-CCHC_6	3.5e-19	79.7	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.423	catalytic activity
GO:0016740	0.359	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0050794	0.982	regulation of cellular process
GO:0019222	0.967	regulation of metabolic process
GO:0048518	0.933	positive regulation of biological process
GO:0031323	0.925	regulation of cellular metabolic process
GO:0048522	0.924	positive regulation of cellular process
GO:0080090	0.913	regulation of primary metabolic process
GO:0051171	0.913	regulation of nitrogen compound metabolic process
GO:0060255	0.912	regulation of macromolecule metabolic process
GO:0009893	0.877	positive regulation of metabolic process
GO:0043170	0.873	macromolecule metabolic process
GO:0019219	0.861	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.784	positive regulation of cellular metabolic process
GO:0051252	0.775	regulation of RNA metabolic process
GO:0010468	0.744	regulation of gene expression
GO:0010604	0.744	positive regulation of macromolecule metabolic process
GO:0031326	0.725	regulation of cellular biosynthetic process
GO:0010556	0.723	regulation of macromolecule biosynthetic process
GO:1903506	0.705	regulation of nucleic acid-templated transcription
GO:0006355	0.704	regulation of DNA-templated transcription
GO:0051173	0.668	positive regulation of nitrogen compound metabolic process
GO:0045935	0.653	positive regulation of nucleobase-containing compound metabolic process
GO:0044260	0.633	cellular macromolecule metabolic process
GO:1903508	0.501	positive regulation of nucleic acid-templated transcription
GO:0045893	0.472	positive regulation of DNA-templated transcription
GO:0019538	0.467	protein metabolic process
GO:0043412	0.465	macromolecule modification
GO:0006139	0.434	nucleobase-containing compound metabolic process
GO:0090304	0.377	nucleic acid metabolic process
GO:0036211	0.352	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043233	0.993	organelle lumen
GO:0070013	0.979	intracellular organelle lumen
GO:0005654	0.973	nucleoplasm
GO:0005694	0.957	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.359	Transferases.

[back to server]