StarFunc result for job id P0C7X0

User Input

>input (464 residues)
MMARRDPTSWAKRLVRAQTLQKQRRAPVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCP
MKCWKAALVPATLGKKEGKENLKPWKPRGEANPGPLNKDKGEKEERPRQQDPQRKALLHM
FSGKPPEKPLPNGKGSTESSDYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVL
ASLSPLRKASLSSSSSLGPKERQTGAAADMPQPAVRHQGREPLLVVKPTHSRPEGGCREV
PQAASKTHGLLQASRPQAQDKRPAVTPQPCPPAATHSLGLGSNLSFGPGAKRPAQAPIQA
CLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGRRTPAQVPSVD
RQPPHSRPCLPTAQACTMSHHSAAGHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86YD7	0.407	0.407	2.491E-57	464	0.920	0.920	Q86YD7.pdb.gz	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	AFDB:Q3U8K7	0.070	0.039	5.584E-1	883	0.149	0.078	Q3U8K7.pdb.gz	KMT5B_MOUSE Histone-lysine N-methyltransferase KMT5B OS=Mus musculus OX=10090 GN=Kmt5b PE=1 SV=2
3	AFDB:Q8N1G0	0.076	0.034	1.092	1237	0.179	0.067	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
4	PDB:7y9tA	0.054	0.065	1.355	380	0.017	0.021	7y9tA.pdb.gz
5	AFDB:D3DMN9	0.060	0.038	1.633	807	0.116	0.067	D3DMN9.pdb.gz	D3DMN9_DROME LD10418p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG11486-RC PE=1 SV=1
6	PDB:5hutA	0.040	0.040	1.657	469	0.013	0.013	5hutA.pdb.gz	Structural and In Vivo Studies on Trehalose-6-Phosphate Synthase from Pathogenic Fungi Provide Insights into Its Catalytic Mechanism, Biological Necessity, and Potential for Novel Antifungal Drug Design.
7	PDB:6edtJ	0.063	0.210	1.657	109	0.022	0.092	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
8	AFDB:E9PV66	0.069	0.018	2.283	2605	0.194	0.035	E9PV66.pdb.gz	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
9	PDB:3sucA	0.044	0.028	2.317	767	0.015	0.009	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
10	AFDB:A0A1D5NXF3	0.067	0.047	2.441	732	0.175	0.111	A0A1D5NXF3.pdb.gz	A0A1D5NXF3_CHICK T-box 3 OS=Gallus gallus OX=9031 GN=TBX3 PE=4 SV=1
11	PDB:3zqjF	0.046	0.036	2.477	607	0.013	0.010	3zqjF.pdb.gz	The Biological and Structural Characterization of Mycobacterium Tuberculosis Uvra Provides Novel Insights Into its Mechanism of Action
12	PDB:4v8mBj	0.059	0.154	2.477	161	0.022	0.062	4v8mBj.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
13	AFDB:P06401	0.064	0.040	2.791	933	0.213	0.106	P06401.pdb.gz	PRGR_HUMAN Progesterone receptor OS=Homo sapiens OX=9606 GN=PGR PE=1 SV=4
14	AFDB:F4JLV7	0.081	0.072	2.985	530	0.179	0.157	F4JLV7.pdb.gz	F4JLV7_ARATH Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g22505 PE=1 SV=1
15	AFDB:O00268	0.078	0.038	2.985	1085	0.200	0.086	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2
16	AFDB:Q9VPZ7	0.073	0.029	2.985	1342	0.170	0.059	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
17	PDB:2jbhB	0.042	0.089	3.464	213	0.004	0.009	2jbhB.pdb.gz	Structural and Functional Studies of the Human Phosphoribosyltransferase Domain Containing Protein 1.
18	PDB:2k8pA	0.046	0.086	3.704	189	0.056	0.138	2k8pA.pdb.gz
19	PDB:6i9ra	0.051	0.225	3.961	83	0.017	0.096	6i9ra.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
20	PDB:7l08V	0.040	0.075	3.961	206	0.030	0.068	7l08V.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86YD7	0.0	804	464	0.920	0.920	F90A1_HUMAN Protein FAM90A1 OS=Homo sapiens OX=9606 GN=FAM90A1 PE=1 SV=3
2	P03347	0.12	37.4	512	0.034	0.031	GAG_HV1B1 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag PE=1 SV=3
3	P04591	0.12	37.4	500	0.034	0.032	GAG_HV1H2 Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag PE=1 SV=3
4	Q77YG1	0.12	37.4	500	0.034	0.032	Q77YG1_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
5	P03348	0.43	35.4	512	0.032	0.029	GAG_HV1BR Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BRU/LAI) OX=11686 GN=gag PE=1 SV=3
6	P04585	0.50	35.4	1435	0.034	0.011	POL_HV1H2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) OX=11706 GN=gag-pol PE=1 SV=4
7	P03366	0.54	35.4	1447	0.034	0.011	POL_HV1B1 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate BH10) OX=11678 GN=gag-pol PE=1 SV=3
8	P04590	0.70	34.7	522	0.058	0.052	GAG_HV2RO Gag polyprotein OS=Human immunodeficiency virus type 2 subtype A (isolate ROD) OX=11720 GN=gag PE=1 SV=3
9	P05888	0.90	34.3	507	0.030	0.028	GAG_HV1MN Gag polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate MN) OX=11696 GN=gag PE=1 SV=3
10	Q72497	1.1	34.3	500	0.030	0.028	Q72497_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
11	Q79791	1.2	34.3	500	0.030	0.028	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1
12	J3QL84	2.0	31.6	105	0.039	0.171	J3QL84_HUMAN Solute carrier family 25 member 19 (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A19 PE=1 SV=8
13	G5EF97	3.1	32.7	699	0.022	0.014	G5EF97_CAEEL Branchpoint-bridging protein OS=Caenorhabditis elegans OX=6239 GN=sfa-1 PE=1 SV=1
14	P12497	4.7	32.3	1435	0.060	0.020	POL_HV1N5 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate NY5) OX=11698 GN=gag-pol PE=1 SV=4
15	D4ACX5	4.9	32.3	833	0.045	0.025	D4ACX5_RAT Histone acetyltransferase OS=Rattus norvegicus OX=10116 GN=Kat2a PE=3 SV=3
16	Q92830	4.9	32.3	837	0.045	0.025	KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens OX=9606 GN=KAT2A PE=1 SV=3
17	Q9JHD2	5.0	32.3	830	0.045	0.025	KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus OX=10090 GN=Kat2a PE=1 SV=2
18	P35963	5.7	32.0	1435	0.030	0.010	POL_HV1Y2 Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group M subtype B (isolate YU-2) OX=362651 GN=gag-pol PE=1 SV=3
19	A0A8I6A7M0	9.7	31.2	1893	0.024	0.006	A0A8I6A7M0_RAT Transcription initiation factor TFIID subunit OS=Rattus norvegicus OX=10116 GN=Taf1 PE=3 SV=1
20	Q80UV9	9.9	31.2	1891	0.024	0.006	TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus OX=10090 GN=Taf1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	1e+02	14.4	Zinc knuckle
2	PF15288 zf-CCHC_6	3.5e-19	79.7	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000012843

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000021987	0.733	Uncharacterized protein
2	9593.ENSGGOP00000028146	0.733	Uncharacterized protein
3	9593.ENSGGOP00000000441	0.689	ALG1, chitobiosyldiphosphodolichol beta-mannosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.440	catalytic activity
GO:0016740	0.401	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0050794	0.983	regulation of cellular process
GO:0019222	0.967	regulation of metabolic process
GO:0031323	0.957	regulation of cellular metabolic process
GO:0048522	0.925	positive regulation of cellular process
GO:0080090	0.908	regulation of primary metabolic process
GO:0060255	0.908	regulation of macromolecule metabolic process
GO:0051171	0.908	regulation of nitrogen compound metabolic process
GO:0043170	0.882	macromolecule metabolic process
GO:0009893	0.879	positive regulation of metabolic process
GO:0019219	0.856	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.844	positive regulation of cellular metabolic process
GO:0051252	0.778	regulation of RNA metabolic process
GO:0010604	0.749	positive regulation of macromolecule metabolic process
GO:0010468	0.730	regulation of gene expression
GO:0031326	0.725	regulation of cellular biosynthetic process
GO:0010556	0.724	regulation of macromolecule biosynthetic process
GO:0006355	0.709	regulation of DNA-templated transcription
GO:0051173	0.708	positive regulation of nitrogen compound metabolic process
GO:0044260	0.675	cellular macromolecule metabolic process
GO:0045935	0.641	positive regulation of nucleobase-containing compound metabolic process
GO:0034641	0.485	cellular nitrogen compound metabolic process
GO:1903508	0.475	positive regulation of nucleic acid-templated transcription
GO:0043412	0.465	macromolecule modification
GO:0006139	0.451	nucleobase-containing compound metabolic process
GO:0045893	0.439	positive regulation of DNA-templated transcription
GO:1901564	0.409	organonitrogen compound metabolic process
GO:0019538	0.402	protein metabolic process
GO:0090304	0.377	nucleic acid metabolic process
GO:0036211	0.353	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0070013	0.978	intracellular organelle lumen
GO:0031981	0.969	nuclear lumen
GO:0005654	0.961	nucleoplasm
GO:0005694	0.958	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.401	Transferases.

[back to server]