StarFunc result for job id P0C851

User Input

>input (137 residues)
MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMS
VGGAILLFGVVITCLAYTLKLSDKSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKH
RQKSNFLRSLKSFFLTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BFY0	0.750	0.760	1.020E-14	135	0.781	0.793	Q8BFY0.pdb.gz	PIRT_MOUSE Phosphoinositide-interacting protein OS=Mus musculus OX=10090 GN=Pirt PE=1 SV=1
2	AFDB:Q9H6X4	0.243	0.191	1.122E-1	195	0.212	0.149	Q9H6X4.pdb.gz	TM134_HUMAN Transmembrane protein 134 OS=Homo sapiens OX=9606 GN=TMEM134 PE=1 SV=1
3	AFDB:G3V7W9	0.392	0.398	1.195E-1	134	0.168	0.172	G3V7W9.pdb.gz	G3V7W9_RAT Interferon induced transmembrane protein 5 OS=Rattus norvegicus OX=10116 GN=Ifitm5 PE=3 SV=1
4	AFDB:Q9NV29	0.373	0.380	1.272E-1	134	0.197	0.201	Q9NV29.pdb.gz	TM100_HUMAN Transmembrane protein 100 OS=Homo sapiens OX=9606 GN=TMEM100 PE=1 SV=2
5	AFDB:Q9A6C1	0.361	0.141	1.853E-1	431	0.117	0.037	Q9A6C1.pdb.gz	Q9A6C1_CAUVC Lysozyme OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=spmX PE=3 SV=1
6	AFDB:B3H683	0.232	0.213	2.535E-1	153	0.095	0.085	B3H683.pdb.gz	B3H683_ARATH Heat shock protein 70 (Hsp 70) family protein OS=Arabidopsis thaliana OX=3702 GN=At4g32208 PE=4 SV=1
7	AFDB:Q14714	0.353	0.230	2.535E-1	243	0.153	0.086	Q14714.pdb.gz	SSPN_HUMAN Sarcospan OS=Homo sapiens OX=9606 GN=SSPN PE=2 SV=3
8	AFDB:Q9CQG9	0.370	0.376	2.535E-1	134	0.212	0.216	Q9CQG9.pdb.gz	TM100_MOUSE Transmembrane protein 100 OS=Mus musculus OX=10090 GN=Tmem100 PE=1 SV=1
9	AFDB:O75069	0.332	0.090	2.874E-1	709	0.161	0.031	O75069.pdb.gz	TMCC2_HUMAN Transmembrane and coiled-coil domains protein 2 OS=Homo sapiens OX=9606 GN=TMCC2 PE=1 SV=3
10	AFDB:Q384D4	0.272	0.091	3.932E-1	554	0.175	0.043	Q384D4.pdb.gz	Q384D4_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0670 PE=4 SV=1
11	PDB:5n9jV	0.325	0.405	1.252	99	0.102	0.141	5n9jV.pdb.gz
12	PDB:7p2pD	0.193	0.283	1.941	86	0.051	0.081	7p2pD.pdb.gz
13	PDB:7e1vM	0.332	0.143	2.201	378	0.095	0.034	7e1vM.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.
14	PDB:4v6xCh	0.208	0.227	2.828	123	0.095	0.106	4v6xCh.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:1f4nA	0.334	0.711	3.011	59	0.036	0.085	1f4nA.pdb.gz	Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.
16	PDB:4o93A	0.289	0.377	3.634	94	0.109	0.160	4o93A.pdb.gz
17	PDB:6s1kE	0.381	0.496	3.634	102	0.058	0.078	6s1kE.pdb.gz
18	PDB:7np7C1	0.272	0.109	3.634	406	0.080	0.027	7np7C1.pdb.gz
19	PDB:7v2wJ	0.345	0.223	3.869	236	0.109	0.064	7v2wJ.pdb.gz
20	PDB:1ohhG	0.340	0.468	4.669	94	0.036	0.053	1ohhG.pdb.gz	The Structure of Bovine F1-ATPase in Complex with its Regulatory Protein If1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BFY0	3.04e-69	206	135	0.781	0.793	PIRT_MOUSE Phosphoinositide-interacting protein OS=Mus musculus OX=10090 GN=Pirt PE=1 SV=1
2	Q12117	0.26	32.7	320	0.117	0.050	MRH1_YEAST Protein MRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRH1 PE=1 SV=1
3	P38079	1.1	31.2	344	0.117	0.047	YRO2_YEAST Protein YRO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YRO2 PE=1 SV=1
4	Q9Y345	1.1	31.2	797	0.088	0.015	SC6A5_HUMAN Sodium- and chloride-dependent glycine transporter 2 OS=Homo sapiens OX=9606 GN=SLC6A5 PE=1 SV=3
5	Q9JHI9	1.2	31.2	570	0.226	0.054	S40A1_MOUSE Solute carrier family 40 member 1 OS=Mus musculus OX=10090 GN=Slc40a1 PE=1 SV=1
6	F4J819	2.5	30.0	705	0.146	0.028	F4J819_ARATH Nicastrin OS=Arabidopsis thaliana OX=3702 GN=NCT PE=1 SV=1
7	Q5TIQ4	4.9	29.3	938	0.109	0.016	Q5TIQ4_ACETH 1,4-beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=celY PE=4 SV=1
8	P58295	6.5	28.9	799	0.080	0.014	SC6A5_RAT Sodium- and chloride-dependent glycine transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a5 PE=1 SV=2
9	Q761V0	6.5	28.9	799	0.080	0.014	SC6A5_MOUSE Sodium- and chloride-dependent glycine transporter 2 OS=Mus musculus OX=10090 GN=Slc6a5 PE=1 SV=1
10	Q9NV29	9.9	27.7	134	0.212	0.216	TM100_HUMAN Transmembrane protein 100 OS=Homo sapiens OX=9606 GN=TMEM100 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14927 Neurensin	0.056	24.6	Neurensin
2	PF07332 Phage_holin_3_6	24	16.4	Putative Actinobacterial Holin-X, holin superfamily III
3	PF15099 PIRT	4.4e-55	196.2	Phosphoinositide-interacting protein family
4	PF16311 TMEM100	0.016	26.3	Transmembrane protein 100

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462046

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000459962	0.890	Transient receptor potential cation channel, subfamily V, member 1
2	9606.ENSP00000461007	0.843	Transient receptor potential cation channel subfamily V member 1
3	9606.ENSP00000323926	0.742	Transient receptor potential cation channel subfamily M member 8
4	9606.ENSP00000262209	0.739	Transient receptor potential cation channel subfamily A member 1
5	9606.ENSP00000360858	0.716	Noelin
6	9606.ENSP00000242315	0.638	PHD finger protein 24
7	9606.ENSP00000287907	0.627	5-hydroxytryptamine receptor 5A
8	9606.ENSP00000334650	0.624	Potassium channel subfamily K member 18
9	9606.ENSP00000263314	0.593	P2X purinoceptor 3
10	9606.ENSP00000295454	0.561	Gamma-aminobutyric acid receptor subunit beta-1
11	9606.ENSP00000368758	0.545	Cortexin-3
12	9606.ENSP00000249016	0.541	Melanin-concentrating hormone receptor 1
13	9606.ENSP00000371294	0.538	Cystinosin
14	9606.ENSP00000256969	0.528	Spexin
15	9606.ENSP00000306124	0.516	Protein kinase C epsilon type
16	9606.ENSP00000275461	0.512	Fer3-like protein
17	9606.ENSP00000298440	0.512	2-oxoglutarate receptor 1
18	9606.ENSP00000314196	0.512	Ghrelin O-acyltransferase
19	9606.ENSP00000329926	0.512	Calcium homeostasis modulator protein 1
20	9606.ENSP00000358807	0.512	Homeobox protein aristaless-like 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044325	1.000	transmembrane transporter binding
GO:1902936	1.000	phosphatidylinositol bisphosphate binding
GO:0005547	1.000	phosphatidylinositol-3,4,5-trisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.988	signal transduction
GO:0034762	0.979	regulation of transmembrane transport
GO:0035556	0.979	intracellular signal transduction
GO:0034765	0.973	regulation of monoatomic ion transmembrane transport
GO:0048017	0.973	inositol lipid-mediated signaling
GO:0022898	0.966	regulation of transmembrane transporter activity
GO:0051050	0.963	positive regulation of transport
GO:0007610	0.955	behavior
GO:1904062	0.955	regulation of monoatomic cation transmembrane transport
GO:0032412	0.955	regulation of monoatomic ion transmembrane transporter activity
GO:0033555	0.938	multicellular organismal response to stress
GO:0043270	0.934	positive regulation of monoatomic ion transport
GO:0034764	0.934	positive regulation of transmembrane transport
GO:0048265	0.920	response to pain
GO:0048015	0.920	phosphatidylinositol-mediated signaling
GO:0034767	0.910	positive regulation of monoatomic ion transmembrane transport
GO:0009628	0.906	response to abiotic stimulus
GO:0009266	0.850	response to temperature stimulus
GO:0009408	0.711	response to heat
GO:0044093	0.647	positive regulation of molecular function
GO:1904064	0.510	positive regulation of cation transmembrane transport
GO:2001257	0.473	regulation of cation channel activity
GO:0032414	0.468	positive regulation of ion transmembrane transporter activity
GO:2001259	0.419	positive regulation of cation channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.764	cytoplasm
GO:0012505	0.740	endomembrane system
GO:0043231	0.668	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]