StarFunc result for job id P0C862

User Input

>input (333 residues)
MRIWWLLLAIEICTGNINSQDTCRQGHPGIPGNPGHNGLPGRDGRDGAKGDKGDAGEPGR
PGSPGKDGTSGEKGERGADGKVEAKGIKGDQGSRGSPGKHGPKGLAGPMGEKGLRGETGP
QGQKGNKGDVGPTGPEGPRGNIGPLGPTGLPGPMGPIGKPGPKGEAGPTGPQGEPGVRGI
RGWKGDRGEKGKIGETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGK
FTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDE
VWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RNN3	0.640	0.640	4.666E-44	333	0.976	0.976	B2RNN3.pdb.gz	C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens OX=9606 GN=C1QTNF9B PE=1 SV=1
2	AFDB:Q4ZJN1	0.539	0.539	2.203E-41	333	0.847	0.847	Q4ZJN1.pdb.gz	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
3	AFDB:P83371	0.406	0.268	3.370E-20	508	0.471	0.309	P83371.pdb.gz	OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta OX=8018 GN=otol1 PE=1 SV=1
4	AFDB:Q4ZJM7	0.407	0.283	1.591E-17	482	0.432	0.299	Q4ZJM7.pdb.gz	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
5	AFDB:Q8K479	0.397	0.540	1.865E-17	243	0.294	0.403	Q8K479.pdb.gz	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
6	AFDB:A2RQR3	0.392	0.203	3.645E-16	655	0.411	0.209	A2RQR3.pdb.gz	A2RQR3_DANRE Collagen alpha-1(X) chain precursor OS=Danio rerio OX=7955 GN=wu:fa66d11 PE=4 SV=1
7	AFDB:F1R9R1	0.352	0.138	7.606E-13	893	0.165	0.062	F1R9R1.pdb.gz
8	PDB:5kc6B	0.350	0.770	5.421E-11	144	0.117	0.271	5kc6B.pdb.gz
9	AFDB:Q05A80	0.364	0.126	1.536E-10	1031	0.204	0.066	Q05A80.pdb.gz	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
10	PDB:5h4bA	0.332	0.764	5.907E-10	136	0.123	0.301	5h4bA.pdb.gz
11	PDB:7e57B	0.236	0.592	5.819E-4	123	0.051	0.138	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
12	PDB:7l2zF	0.179	0.100	9.195E-3	664	0.051	0.026	7l2zF.pdb.gz
13	PDB:5a3oA	0.205	0.508	2.150E-2	114	0.060	0.175	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
14	PDB:6oj0A	0.200	0.330	2.803E-2	178	0.042	0.079	6oj0A.pdb.gz
15	PDB:5jovA	0.138	0.053	3.854E-2	949	0.033	0.012	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
16	PDB:5eiyB	0.166	0.093	4.520E-2	658	0.039	0.020	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
17	PDB:2waaA	0.173	0.172	5.026E-2	335	0.042	0.042	2waaA.pdb.gz
18	PDB:5nxsA	0.146	0.161	5.300E-2	290	0.048	0.055	5nxsA.pdb.gz
19	AFDB:A0A1D8PPZ7	0.146	0.103	8.375E-2	520	0.147	0.094	A0A1D8PPZ7.pdb.gz	A0A1D8PPZ7_CANAL Mif2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MIF2 PE=3 SV=1
20	AFDB:Q6P1D5	0.133	0.061	9.313E-2	963	0.141	0.049	Q6P1D5.pdb.gz	SE6L1_MOUSE Seizure 6-like protein OS=Mus musculus OX=10090 GN=Sez6l PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RNN3	0.0	647	333	0.976	0.976	C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens OX=9606 GN=C1QTNF9B PE=1 SV=1
2	D3ZJ76	0.0	530	331	0.838	0.843	D3ZJ76_RAT C1q and TNF related 9 OS=Rattus norvegicus OX=10116 GN=C1qtnf9 PE=4 SV=3
3	P0C862	0.0	662	333	1.000	1.000	C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens OX=9606 GN=C1QTNF9 PE=1 SV=1
4	Q4ZJN1	0.0	541	333	0.847	0.847	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
5	P83371	2.39e-66	218	508	0.459	0.301	OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta OX=8018 GN=otol1 PE=1 SV=1
6	A5PN28	2.23e-65	216	489	0.432	0.294	OTO1A_DANRE Otolin-1-A OS=Danio rerio OX=7955 GN=otol1a PE=1 SV=1
7	Q4ZJM7	2.29e-62	207	482	0.426	0.295	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
8	A8K660	6.79e-53	176	244	0.282	0.385	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
9	Q15848	6.79e-53	176	244	0.282	0.385	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
10	Q3Y5Z3	3.24e-51	171	240	0.288	0.400	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
11	Q60994	8.61e-51	171	247	0.315	0.425	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
12	Q8K3R4	2.58e-49	167	244	0.294	0.402	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
13	Q9D8U4	1.48e-43	153	294	0.303	0.344	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
14	Q9BXJ5	3.02e-42	149	285	0.303	0.354	C1QT2_HUMAN Complement C1q tumor necrosis factor-related protein 2 OS=Homo sapiens OX=9606 GN=C1QTNF2 PE=1 SV=1
15	Q8BVD7	5.31e-40	144	289	0.321	0.370	C1QT7_MOUSE Complement C1q tumor necrosis factor-related protein 7 OS=Mus musculus OX=10090 GN=C1qtnf7 PE=2 SV=2
16	A2RQR3	6.63e-37	142	655	0.372	0.189	A2RQR3_DANRE Collagen alpha-1(X) chain precursor OS=Danio rerio OX=7955 GN=wu:fa66d11 PE=4 SV=1
17	Q9BXJ0	2.05e-36	133	243	0.279	0.383	C1QT5_HUMAN Complement C1q tumor necrosis factor-related protein 5 OS=Homo sapiens OX=9606 GN=C1QTNF5 PE=1 SV=1
18	Q4VAQ0	1.88e-35	135	427	0.390	0.304	Q4VAQ0_HUMAN COL8A2 protein OS=Homo sapiens OX=9606 GN=COL8A2 PE=1 SV=1
19	Q8K479	3.89e-35	130	243	0.273	0.374	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
20	P25067	2.71e-33	132	703	0.216	0.102	CO8A2_HUMAN Collagen alpha-2(VIII) chain OS=Homo sapiens OX=9606 GN=COL8A2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18573 BclA_C	0.0034	28.7	BclA C-terminal domain
2	PF00386 C1q	2.5e-35	132.9	C1q domain
3	PF01391 Collagen	2e-25	99.6	Collagen triple helix repeat (20 copies)
4	PF09083 DUF1923	82	14.3	Domain of unknown function (DUF1923)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371503

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269141	0.791	Cadherin-2
2	9606.ENSP00000369889	0.706	Collagen alpha-1(II) chain
3	9606.ENSP00000329137	0.700	Adipolin
4	9606.ENSP00000341785	0.687	Adiponectin receptor protein 1
5	9606.ENSP00000371572	0.684	Complement C1q and tumor necrosis factor-related protein 9B
6	9606.ENSP00000442304	0.573	Erythroferrone

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.986	identical protein binding
GO:0005102	0.708	signaling receptor binding
GO:0048018	0.483	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0065007	0.974	biological regulation
GO:0071704	0.936	organic substance metabolic process
GO:0050789	0.932	regulation of biological process
GO:0050794	0.873	regulation of cellular process
GO:0044238	0.852	primary metabolic process
GO:0044237	0.851	cellular metabolic process
GO:0019222	0.837	regulation of metabolic process
GO:0051174	0.812	regulation of phosphorus metabolic process
GO:0045859	0.757	regulation of protein kinase activity
GO:0042327	0.751	positive regulation of phosphorylation
GO:0043085	0.718	positive regulation of catalytic activity
GO:0032787	0.693	monocarboxylic acid metabolic process
GO:0051247	0.680	positive regulation of protein metabolic process
GO:0034440	0.638	lipid oxidation
GO:0050896	0.614	response to stimulus
GO:0071900	0.605	regulation of protein serine/threonine kinase activity
GO:0032501	0.560	multicellular organismal process
GO:0071840	0.471	cellular component organization or biogenesis
GO:0048583	0.459	regulation of response to stimulus
GO:0016043	0.455	cellular component organization
GO:0031401	0.353	positive regulation of protein modification process
GO:0065008	0.317	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005615	0.984	extracellular space
GO:0005622	0.714	intracellular anatomical structure
GO:0071944	0.314	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]