StarFunc result for job id P0C869

User Input

>input (781 residues)
MAVAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEG
RLEVEFRLQSLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGP
QEASVGTGTFRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMR
VELKKEAGLRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKNKLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSDSFREYSAPGVRRTPEEA
AAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQAVQRRRQRRP
H

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C869	1.000	1.000	0.000	781	1.000	1.000	P0C869.pdb.gz	PA24B_HUMAN Cytosolic phospholipase A2 beta OS=Homo sapiens OX=9606 GN=PLA2G4B PE=1 SV=2
2	AFDB:P0C871	0.983	0.982	0.000	782	0.818	0.817	P0C871.pdb.gz	PA24B_MOUSE Cytosolic phospholipase A2 beta OS=Mus musculus OX=10090 GN=Pla2g4b PE=1 SV=1
3	AFDB:Q50L43	0.925	0.876	1.922E-86	825	0.492	0.465	Q50L43.pdb.gz	PA24D_MOUSE Cytosolic phospholipase A2 delta OS=Mus musculus OX=10090 GN=Pla2g4d PE=1 SV=3
4	AFDB:Q86XP0	0.918	0.878	6.229E-86	818	0.511	0.488	Q86XP0.pdb.gz	PA24D_HUMAN Cytosolic phospholipase A2 delta OS=Homo sapiens OX=9606 GN=PLA2G4D PE=1 SV=2
5	PDB:5iz5A	0.890	0.918	4.431E-83	757	0.498	0.514	5iz5A.pdb.gz
6	AFDB:Q3MJ16	0.900	0.811	3.572E-82	868	0.451	0.406	Q3MJ16.pdb.gz	PA24E_HUMAN Cytosolic phospholipase A2 epsilon OS=Homo sapiens OX=9606 GN=PLA2G4E PE=1 SV=4
7	AFDB:Q50L42	0.896	0.801	3.429E-79	875	0.428	0.382	Q50L42.pdb.gz	PA24E_MOUSE Cytosolic phospholipase A2 epsilon OS=Mus musculus OX=10090 GN=Pla2g4e PE=1 SV=1
8	PDB:5iz5B	0.856	0.894	2.797E-78	746	0.493	0.516	5iz5B.pdb.gz
9	AFDB:Q68DD2	0.874	0.806	6.679E-75	849	0.411	0.378	Q68DD2.pdb.gz	PA24F_HUMAN Cytosolic phospholipase A2 zeta OS=Homo sapiens OX=9606 GN=PLA2G4F PE=1 SV=3
10	AFDB:Q50L41	0.854	0.782	1.489E-73	855	0.412	0.377	Q50L41.pdb.gz	PA24F_MOUSE Cytosolic phospholipase A2 zeta OS=Mus musculus OX=10090 GN=Pla2g4f PE=1 SV=3
11	PDB:5ixcA	0.803	0.912	8.372E-71	684	0.470	0.537	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	PDB:5izrC	0.764	0.898	1.553E-67	659	0.447	0.530	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
13	AFDB:P50392	0.595	0.626	8.505E-49	741	0.232	0.244	P50392.pdb.gz	PA24A_DANRE Cytosolic phospholipase A2 OS=Danio rerio OX=7955 GN=pla2g4a PE=2 SV=1
14	AFDB:A0A0R4ICC9	0.600	0.647	1.643E-48	720	0.245	0.265	A0A0R4ICC9.pdb.gz
15	PDB:1cjyA	0.562	0.687	3.462E-43	633	0.239	0.295	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
16	PDB:6kxkD	0.126	0.168	4.945E-7	553	0.045	0.063	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
17	PDB:5a50A	0.129	0.553	2.447E-6	165	0.036	0.170	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5a52A	0.126	0.579	4.105E-6	154	0.040	0.201	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:4rj9A	0.109	0.485	9.133E-6	161	0.041	0.199	4rj9A.pdb.gz
20	PDB:3nsjA	0.137	0.198	2.340E-5	530	0.032	0.047	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0C869	0.0	1607	781	1.000	1.000	PA24B_HUMAN Cytosolic phospholipase A2 beta OS=Homo sapiens OX=9606 GN=PLA2G4B PE=1 SV=2
2	P0C871	0.0	1302	782	0.809	0.808	PA24B_MOUSE Cytosolic phospholipase A2 beta OS=Mus musculus OX=10090 GN=Pla2g4b PE=1 SV=1
3	Q3MJ16	0.0	615	868	0.448	0.403	PA24E_HUMAN Cytosolic phospholipase A2 epsilon OS=Homo sapiens OX=9606 GN=PLA2G4E PE=1 SV=4
4	Q50L41	0.0	592	855	0.426	0.389	PA24F_MOUSE Cytosolic phospholipase A2 zeta OS=Mus musculus OX=10090 GN=Pla2g4f PE=1 SV=3
5	Q50L42	0.0	598	875	0.428	0.382	PA24E_MOUSE Cytosolic phospholipase A2 epsilon OS=Mus musculus OX=10090 GN=Pla2g4e PE=1 SV=1
6	Q50L43	0.0	724	825	0.489	0.463	PA24D_MOUSE Cytosolic phospholipase A2 delta OS=Mus musculus OX=10090 GN=Pla2g4d PE=1 SV=3
7	Q68DD2	0.0	588	849	0.430	0.396	PA24F_HUMAN Cytosolic phospholipase A2 zeta OS=Homo sapiens OX=9606 GN=PLA2G4F PE=1 SV=3
8	Q86XP0	0.0	763	818	0.520	0.496	PA24D_HUMAN Cytosolic phospholipase A2 delta OS=Homo sapiens OX=9606 GN=PLA2G4D PE=1 SV=2
9	P50392	6.87e-65	232	741	0.222	0.233	PA24A_DANRE Cytosolic phospholipase A2 OS=Danio rerio OX=7955 GN=pla2g4a PE=2 SV=1
10	P47712	1.69e-49	188	749	0.143	0.150	PA24A_HUMAN Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2
11	P50393	2.64e-49	188	752	0.143	0.149	PA24A_RAT Cytosolic phospholipase A2 OS=Rattus norvegicus OX=10116 GN=Pla2g4a PE=1 SV=1
12	P47713	3.30e-49	187	748	0.143	0.150	PA24A_MOUSE Cytosolic phospholipase A2 OS=Mus musculus OX=10090 GN=Pla2g4a PE=1 SV=1
13	Q9UP65	1.07e-41	162	541	0.177	0.255	PA24C_HUMAN Cytosolic phospholipase A2 gamma OS=Homo sapiens OX=9606 GN=PLA2G4C PE=1 SV=2
14	Q64GA5	1.64e-31	132	597	0.108	0.141	PA24C_MOUSE Cytosolic phospholipase A2 gamma OS=Mus musculus OX=10090 GN=Pla2g4c PE=1 SV=1
15	Q6NNV2	6.15e-09	60.8	327	0.042	0.101	Q6NNV2_DROME RE44043p OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=1 SV=1
16	H9XVN2	6.52e-09	60.8	345	0.042	0.096	H9XVN2_DROME Synaptotagmin 7, isoform I OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=1 SV=1
17	Q59DP7	6.94e-09	60.1	283	0.042	0.117	Q59DP7_DROME Synaptotagmin 7, isoform F OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=4 SV=1
18	Q9V4C4	1.20e-08	60.5	416	0.042	0.079	Q9V4C4_DROME Synaptotagmin 7, isoform A OS=Drosophila melanogaster OX=7227 GN=Syt7 PE=1 SV=4
19	Q9R0N7	4.88e-08	58.5	403	0.054	0.104	SYT7_MOUSE Synaptotagmin-7 OS=Mus musculus OX=10090 GN=Syt7 PE=1 SV=1
20	Q62747	6.34e-08	58.2	403	0.052	0.102	SYT7_RAT Synaptotagmin-7 OS=Rattus norvegicus OX=10116 GN=Syt7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	2.2e-14	65.0	C2 domain
2	PF18695 cPLA2_C2	1.8e-21	87.5	Cytosolic phospholipases A2 C2-domain
3	PF01735 PLA2_B	1.7e-25	101.1	Lysophospholipase catalytic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396045

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216037	0.900	X-box-binding protein 1
2	9606.ENSP00000274793	0.840	Platelet-activating factor acetylhydrolase
3	9606.ENSP00000360141	0.831	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
4	9606.ENSP00000286548	0.828	Guanine nucleotide-binding protein G(q) subunit alpha
5	9606.ENSP00000384610	0.799	Patatin-like phospholipase domain-containing protein 7
6	9606.ENSP00000219345	0.794	Group XV phospholipase A2
7	9606.ENSP00000407509	0.769	Neuropathy target esterase
8	9606.ENSP00000344166	0.764	TMEM189-UBE2V1 readthrough
9	9606.ENSP00000369530	0.762	Arachidonate 15-lipoxygenase B
10	9606.ENSP00000363400	0.757	Platelet-activating factor acetylhydrolase 2, cytoplasmic
11	9606.ENSP00000315167	0.746	Arachidonate 12-lipoxygenase, 12R-type
12	9606.ENSP00000263431	0.725	Protein kinase C gamma type
13	9606.ENSP00000364249	0.721	Calcium-dependent phospholipase A2
14	9606.ENSP00000251535	0.719	Arachidonate 12-lipoxygenase, 12S-type
15	9606.ENSP00000458832	0.705	Arachidonate 15-lipoxygenase
16	9606.ENSP00000320337	0.704	HRAS-like suppressor 3
17	9606.ENSP00000360247	0.703	Cytochrome P450 2J2
18	9606.ENSP00000221307	0.701	Docosahexaenoic acid omega-hydroxylase CYP4F3
19	9606.ENSP00000312999	0.699	Guanine nucleotide-binding protein G(i) subunit alpha-2
20	9606.ENSP00000330442	0.699	Phospholipase B1, membrane-associated

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008970	1.000	phospholipase A1 activity
GO:0004623	1.000	phospholipase A2 activity
GO:0004622	0.999	lysophospholipase activity
GO:0047498	0.973	calcium-dependent phospholipase A2 activity
GO:0005488	0.864	binding
GO:0005515	0.409	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006644	0.991	phospholipid metabolic process
GO:0046470	0.965	phosphatidylcholine metabolic process
GO:0046434	0.938	organophosphate catabolic process
GO:0046471	0.934	phosphatidylglycerol metabolic process
GO:0016042	0.893	lipid catabolic process
GO:0044242	0.884	cellular lipid catabolic process
GO:0009395	0.828	phospholipid catabolic process
GO:0046475	0.796	glycerophospholipid catabolic process
GO:0065007	0.376	biological regulation
GO:0050789	0.307	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0012505	0.990	endomembrane system
GO:0016020	0.978	membrane
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0031090	0.950	organelle membrane
GO:0031982	0.743	vesicle
GO:0005739	0.664	mitochondrion
GO:0005576	0.598	extracellular region
GO:0031410	0.589	cytoplasmic vesicle
GO:0031967	0.553	organelle envelope
GO:0098588	0.482	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18689	1.000	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
RHEA:15801	1.000	a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+)
EC:3.1.1.4	1.000	phospholipase A2.
EC:3.1.1.32	1.000	phospholipase A1.
RHEA:15177	0.999	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	0.999	lysophospholipase.

[back to server]