StarFunc result for job id P0CB38

User Input

>input (370 residues)
MNVAAKYRMASLYVGDLHADVTEDLLFRKFSTVGPVLSIRICRDQVTRRSLGYAYVNFLQ
LADAQKALDTMNFDIIKGKSIRLMWSQRDAYLRRSGIGNVFIKNLDKSIDNKTLYEHFSA
FGKILSSKVMSDDQGSKGYAFVHFQNQSAADRAIEEMNGKLLKGCKVFVGRFKNRKDREA
ELRSKASEFTNVYIKNFGGDMDDERLKDVFSKYGKTLSVKVMTDSSGKSKGFGFVSFDSH
EAAKKAVEEMNGRDINGQLIFVGRAQKKVERQAELKQMFEQLKRERIRGCQGVKLYIKNL
DDTIDDEKLRNEFSSFGSISRVKVMQEEGQSKGFGLICFSSPEDATKAMTEMNGRILGSK
PLSIALAQRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3KFU5	0.812	0.503	1.805E-69	631	0.749	0.439	A3KFU5.pdb.gz	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
2	AFDB:H0YAR2	0.838	0.541	2.048E-69	599	0.716	0.442	H0YAR2.pdb.gz	H0YAR2_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
3	AFDB:Q6PHQ9	0.869	0.507	2.991E-69	660	0.749	0.420	Q6PHQ9.pdb.gz	Q6PHQ9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
4	AFDB:A0A024R9C1	0.778	0.482	6.380E-69	636	0.716	0.417	A0A024R9C1.pdb.gz
5	AFDB:Q98SP8	0.619	0.409	2.817E-67	629	0.657	0.386	Q98SP8.pdb.gz	EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis OX=8355 GN=epabp-a PE=1 SV=2
6	AFDB:Q6TGY6	0.839	0.523	7.735E-67	620	0.651	0.389	Q6TGY6.pdb.gz
7	AFDB:Q62029	0.486	0.300	3.206E-65	628	0.657	0.387	Q62029.pdb.gz	Q62029_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc2 PE=1 SV=1
8	AFDB:A2A5N3	0.850	0.538	1.207E-64	607	0.605	0.369	A2A5N3.pdb.gz	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
9	AFDB:Q4VXU2	0.848	0.533	2.742E-64	614	0.635	0.383	Q4VXU2.pdb.gz	PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens OX=9606 GN=PABPC1L PE=2 SV=1
10	AFDB:Q96DU9	0.537	0.523	4.279E-62	382	0.608	0.589	Q96DU9.pdb.gz	PABP5_HUMAN Polyadenylate-binding protein 5 OS=Homo sapiens OX=9606 GN=PABPC5 PE=1 SV=1
11	PDB:6r5kH	0.489	0.466	7.197E-34	394	0.492	0.462	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
12	PDB:5vsuA	0.260	0.253	1.884E-23	387	0.154	0.147	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	PDB:6y53o	0.223	0.464	5.397E-16	160	0.195	0.450	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:7oqcF	0.205	0.283	4.206E-14	267	0.135	0.187	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
15	PDB:5lsbA	0.206	0.415	8.706E-13	176	0.143	0.301	5lsbA.pdb.gz
16	PDB:7evoD	0.211	0.386	2.546E-12	200	0.122	0.225	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.201	0.402	2.720E-10	178	0.116	0.242	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:5yzg1	0.208	0.315	1.496E-9	243	0.159	0.243	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:6ff7X	0.200	0.419	2.812E-9	171	0.089	0.193	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
20	PDB:6gd1A	0.221	0.418	5.465E-8	190	0.073	0.142	6gd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KFU5	0.0	585	631	0.751	0.441	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
2	A3KFU8	0.0	583	644	0.751	0.432	A3KFU8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
3	B1ANR0	0.0	588	615	0.754	0.454	B1ANR0_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
4	F1QB54	0.0	562	634	0.692	0.404	PABPA_DANRE Polyadenylate-binding protein 1A OS=Danio rerio OX=7955 GN=pabpc1a PE=1 SV=1
5	H0YAR2	0.0	576	599	0.722	0.446	H0YAR2_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
6	P11940	0.0	577	636	0.722	0.420	PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2
7	P20965	0.0	567	633	0.711	0.415	PABPA_XENLA Polyadenylate-binding protein 1-A OS=Xenopus laevis OX=8355 GN=pabpc1-a PE=1 SV=3
8	P29341	0.0	576	636	0.719	0.418	PABP1_MOUSE Polyadenylate-binding protein 1 OS=Mus musculus OX=10090 GN=Pabpc1 PE=1 SV=2
9	P61286	0.0	577	636	0.722	0.420	PABP1_BOVIN Polyadenylate-binding protein 1 OS=Bos taurus OX=9913 GN=PABPC1 PE=2 SV=1
10	Q13310	0.0	587	644	0.754	0.433	PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
11	Q5VX58	0.0	540	631	0.678	0.398	Q5VX58_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC3 PE=2 SV=1
12	Q62029	0.0	523	628	0.657	0.387	Q62029_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc2 PE=1 SV=1
13	Q6PHQ9	0.0	583	660	0.751	0.421	Q6PHQ9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
14	Q803E7	0.0	534	620	0.651	0.389	Q803E7_DANRE Polyadenylate-binding protein OS=Danio rerio OX=7955 GN=zgc:55855 PE=1 SV=1
15	Q91YZ8	0.0	584	615	0.751	0.452	Q91YZ8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
16	Q98SP8	0.0	536	629	0.651	0.383	EPABA_XENLA Embryonic polyadenylate-binding protein A OS=Xenopus laevis OX=8355 GN=epabp-a PE=1 SV=2
17	Q99LF8	0.0	584	660	0.751	0.421	Q99LF8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=2 SV=1
18	Q9EPH8	0.0	575	636	0.719	0.418	PABP1_RAT Polyadenylate-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Pabpc1 PE=1 SV=1
19	Q9H361	0.0	540	631	0.678	0.398	PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens OX=9606 GN=PABPC3 PE=1 SV=2
20	Q4VXU2	3.76e-180	515	614	0.635	0.383	PAP1L_HUMAN Polyadenylate-binding protein 1-like OS=Homo sapiens OX=9606 GN=PABPC1L PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07576 BRAP2	1.5	20.4	BRCA1-associated protein 2
2	PF15023 DUF4523	0.11	23.7	Protein of unknown function (DUF4523)
3	PF19575 HTH_58	2.7e+02	13.2	Helix-turn-helix domain
4	PF11608 MARF1_RRM1	0.00015	33.2	MARF1, RNA recognition motif 1
5	PF05573 NosL	6.2	18.6	NosL
6	PF05172 Nup35_RRM	0.00024	32.3	Nup53/35/40-type RNA recognition motif
7	PF14605 Nup35_RRM_2	0.00075	30.8	Nup53/35/40-type RNA recognition motif
8	PF08206 OB_RNB	7.8e+02	11.2	Ribonuclease B OB domain
9	PF14703 PHM7_cyt	14	17.4	Cytosolic domain of 10TM putative phosphate transporter
10	PF00076 RRM_1	3e-81	278.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
11	PF08777 RRM_3	0.0067	27.8	RNA binding motif
12	PF13893 RRM_5	1.2e-10	52.6	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
13	PF16367 RRM_7	5.8e-08	44.1	RNA recognition motif
14	PF11835 RRM_8	6.4	18.4	RRM-like domain
15	PF16842 RRM_occluded	6.5e-05	34.1	Occluded RNA-recognition motif
16	PF11767 SET_assoc	0.048	24.6	Histone lysine methyltransferase SET associated
17	PF03468 XS	3.9	19.2	XS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000463233

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302768	0.877	Polyadenylate-binding protein-interacting protein 1
2	9606.ENSP00000373575	0.685	Uncharacterized protein C6orf163
3	9606.ENSP00000420854	0.601	EF-hand calcium-binding domain-containing protein 12
4	9606.ENSP00000478754	0.571	Probable ATP-dependent RNA helicase DDX6
5	9606.ENSP00000356520	0.558	ATP-dependent RNA helicase A
6	9606.ENSP00000414904	0.513	Cathepsin O
7	9606.ENSP00000355890	0.500	Bifunctional glutamate/proline--tRNA ligase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.996	protein binding
GO:0003729	0.943	mRNA binding
GO:0003727	0.533	single-stranded RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0044238	0.988	primary metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0034641	0.971	cellular nitrogen compound metabolic process
GO:0043170	0.969	macromolecule metabolic process
GO:0050789	0.955	regulation of biological process
GO:0010467	0.931	gene expression
GO:0060255	0.878	regulation of macromolecule metabolic process
GO:0050794	0.845	regulation of cellular process
GO:0051171	0.842	regulation of nitrogen compound metabolic process
GO:0010468	0.837	regulation of gene expression
GO:0080090	0.823	regulation of primary metabolic process
GO:0031323	0.758	regulation of cellular metabolic process
GO:1901360	0.757	organic cyclic compound metabolic process
GO:0016070	0.749	RNA metabolic process
GO:0048518	0.459	positive regulation of biological process
GO:0016071	0.457	mRNA metabolic process
GO:0009892	0.442	negative regulation of metabolic process
GO:0010605	0.430	negative regulation of macromolecule metabolic process
GO:0010604	0.415	positive regulation of macromolecule metabolic process
GO:0031326	0.391	regulation of cellular biosynthetic process
GO:0019219	0.381	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.378	regulation of macromolecule biosynthetic process
GO:0051252	0.366	regulation of RNA metabolic process
GO:0010608	0.347	post-transcriptional regulation of gene expression
GO:0051246	0.327	regulation of protein metabolic process
GO:0006396	0.323	RNA processing
GO:0006417	0.318	regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005622	0.999	intracellular anatomical structure
GO:0043227	0.963	membrane-bounded organelle
GO:0043229	0.963	intracellular organelle
GO:0005737	0.938	cytoplasm
GO:0043231	0.927	intracellular membrane-bounded organelle
GO:0005634	0.913	nucleus
GO:0032991	0.855	protein-containing complex
GO:0005829	0.849	cytosol
GO:0005576	0.825	extracellular region
GO:0031982	0.423	vesicle
GO:0043228	0.371	non-membrane-bounded organelle
GO:0005615	0.335	extracellular space
GO:0070062	0.329	extracellular exosome
GO:0099080	0.317	supramolecular complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]