StarFunc result for job id P0CB47

User Input

>input (393 residues)
MALPRSQGHWSNKDILRLLECMENNRPSDDNSTFSSTQSHMDWGKVAFKNFSGEMCRLKW
LEISCNLRKFGTLKELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQ
MYPGMRSQELTKILSKKYRELPEQMKQKYIQDFRKEKQEFEEKLARFREEHPDLVQKAKK
SSVSKRTQNKVQKKFQKNIEEVRSLPKTDRFFKKVKFHGEPQKPPMNGYHKFHQDSWSSK
EMQHLSVRERMVEIGRRWQRIPQSQKDHFKSQAEELQKQYKVKLDLWLKTLSPENYAAYK
ESTYAKGKNMAMTGGPDPRLKQADPQSSSAKGLQEGFGEGQGLQAAGTDSSQTIWVNCHV
SMEPEENRKKDREKEESSNSSDCSSGEEIEVDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CB47	1.000	1.000	4.666E-55	393	1.000	1.000	P0CB47.pdb.gz	UBFL1_HUMAN Upstream-binding factor 1-like protein 1 OS=Homo sapiens OX=9606 GN=UBTFL1 PE=1 SV=1
2	AFDB:Q3USZ2	0.277	0.276	2.418E-31	394	0.524	0.523	Q3USZ2.pdb.gz	UBFL1_MOUSE Upstream-binding factor 1-like protein 1 OS=Mus musculus OX=10090 GN=Ubtfl1 PE=1 SV=1
3	AFDB:P25976	0.291	0.166	6.053E-23	765	0.504	0.259	P25976.pdb.gz	UBF1_MOUSE Nucleolar transcription factor 1 OS=Mus musculus OX=10090 GN=Ubtf PE=1 SV=1
4	AFDB:E9PKP7	0.312	0.183	1.234E-22	745	0.496	0.262	E9PKP7.pdb.gz	E9PKP7_HUMAN Upstream binding transcription factor OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1
5	AFDB:A0A024R1S7	0.200	0.192	7.258E-5	411	0.137	0.131	A0A024R1S7.pdb.gz
6	AFDB:Q9SUP7	0.205	0.178	1.207E-4	456	0.120	0.103	Q9SUP7.pdb.gz	HMGB6_ARATH High mobility group B protein 6 OS=Arabidopsis thaliana OX=3702 GN=HMGB6 PE=2 SV=1
7	AFDB:Q803S1	0.219	0.206	4.095E-4	420	0.132	0.124	Q803S1.pdb.gz	Q803S1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Danio rerio OX=7955 GN=baf57 PE=1 SV=2
8	AFDB:Q9BIW6	0.187	0.103	2.310E-3	749	0.125	0.065	Q9BIW6.pdb.gz	Q9BIW6_DROME Brahma-associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=2 SV=1
9	AFDB:Q9USU7	0.163	0.201	6.393E-3	310	0.081	0.103	Q9USU7.pdb.gz	YHHB_SCHPO HMG box-containing protein C28F2.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC28F2.11 PE=1 SV=1
10	AFDB:Q9T012	0.202	0.181	7.078E-3	446	0.122	0.108	Q9T012.pdb.gz	HMG13_ARATH High mobility group B protein 13 OS=Arabidopsis thaliana OX=3702 GN=HMGB13 PE=2 SV=1
11	PDB:1j5nA	0.154	0.584	2.230E-1	93	0.048	0.204	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.118	0.103	1.136	451	0.041	0.035	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:7dcoL	0.095	0.086	2.093	435	0.097	0.087	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
14	PDB:7m1sA	0.095	0.073	2.317	577	0.112	0.076	7m1sA.pdb.gz
15	PDB:7vnrA	0.080	0.091	2.438	333	0.066	0.078	7vnrA.pdb.gz	Structural insights into the lipid and ligand regulation of a human neuronal KCNQ channel.
16	PDB:4alyA	0.102	0.157	2.565	211	0.048	0.090	4alyA.pdb.gz
17	PDB:4xy3A	0.073	0.106	2.840	243	0.051	0.082	4xy3A.pdb.gz
18	PDB:7bylA	0.110	0.118	3.663	354	0.087	0.096	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
19	PDB:6ikoA	0.087	0.112	3.854	303	0.097	0.125	6ikoA.pdb.gz
20	PDB:6zm7CE	0.099	0.303	6.093	124	0.051	0.161	6zm7CE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CB47	0.0	817	393	1.000	1.000	UBFL1_HUMAN Upstream-binding factor 1-like protein 1 OS=Homo sapiens OX=9606 GN=UBTFL1 PE=1 SV=1
2	Q3USZ2	1.55e-124	367	394	0.496	0.495	UBFL1_MOUSE Upstream-binding factor 1-like protein 1 OS=Mus musculus OX=10090 GN=Ubtfl1 PE=1 SV=1
3	E9PKP7	2.69e-82	268	745	0.372	0.196	E9PKP7_HUMAN Upstream binding transcription factor OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1
4	P17480	6.72e-72	241	764	0.366	0.188	UBF1_HUMAN Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1
5	P25976	6.83e-72	241	765	0.366	0.188	UBF1_MOUSE Nucleolar transcription factor 1 OS=Mus musculus OX=10090 GN=Ubtf PE=1 SV=1
6	P25977	7.15e-72	241	764	0.366	0.188	UBF1_RAT Nucleolar transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Ubtf PE=1 SV=1
7	E5KSU5	7.96e-10	61.2	246	0.115	0.183	E5KSU5_HUMAN Mitochondrial transcription factor A OS=Homo sapiens OX=9606 GN=TFAM PE=4 SV=1
8	Q00059	7.96e-10	61.2	246	0.115	0.183	TFAM_HUMAN Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1
9	Q91ZW1	2.02e-09	60.1	244	0.109	0.176	TFAM_RAT Transcription factor A, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tfam PE=2 SV=1
10	H7BYN3	2.29e-08	56.2	219	0.104	0.187	H7BYN3_HUMAN Transcription factor A, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1
11	P40630	1.01e-07	54.7	243	0.104	0.169	TFAM_MOUSE Transcription factor A, mitochondrial OS=Mus musculus OX=10090 GN=Tfam PE=1 SV=2
12	Q9VDL2	3.50e-06	50.4	257	0.102	0.156	Q9VDL2_DROME LD40493p OS=Drosophila melanogaster OX=7227 GN=TFAM PE=1 SV=1
13	Q86BR8	5.15e-06	50.1	284	0.102	0.141	Q86BR8_DROME Mitochondrial transcription factor A, isoform B OS=Drosophila melanogaster OX=7227 GN=TFAM PE=1 SV=1
14	Q9Z104	3.34e-05	47.8	317	0.076	0.095	HM20B_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Mus musculus OX=10090 GN=Hmg20b PE=1 SV=1
15	C9JQA7	5.47e-05	45.1	142	0.059	0.162	C9JQA7_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
16	C9J8X5	7.04e-05	45.8	215	0.059	0.107	C9J8X5_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
17	Q9P0W2	1.10e-04	46.2	317	0.059	0.073	HM20B_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
18	Q02486	1.38e-04	44.7	183	0.064	0.137	ABF2_YEAST ARS-binding factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABF2 PE=1 SV=1
19	Q9DC33	0.002	42.4	346	0.053	0.061	HM20A_MOUSE High mobility group protein 20A OS=Mus musculus OX=10090 GN=Hmg20a PE=1 SV=1
20	Q9NP66	0.002	42.7	347	0.053	0.061	HM20A_HUMAN High mobility group protein 20A OS=Homo sapiens OX=9606 GN=HMG20A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06244 Ccdc124	8.9e+02	11.6	Coiled-coil domain-containing protein 124 /Oxs1
2	PF09626 DHC	4.6e+02	13.2	Dihaem cytochrome c
3	PF11166 DUF2951	79	14.9	Protein of unknown function (DUF2951)
4	PF14747 DUF4473	4.8e+02	12.7	Domain of unknown function (DUF4473)
5	PF00505 HMG_box	2.3e-15	68.1	HMG (high mobility group) box
6	PF09011 HMG_box_2	3.6e-09	48.4	HMG-box domain
7	PF08641 Mis14	6.8e+02	12.0	Kinetochore protein Mis14 like
8	PF00249 Myb_DNA-binding	2.1e+02	13.6	Myb-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485108

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351575	0.744	Transcription factor TFIIIB component B'' homolog
2	9606.ENSP00000370408	0.616	Homeobox protein CDX-2
3	9606.ENSP00000321963	0.610	Zinc finger and SCAN domain-containing protein 4
4	9606.ENSP00000216297	0.518	FACT complex subunit SPT16
5	9606.ENSP00000343062	0.517	Olfactory receptor 2T2
6	9606.ENSP00000368798	0.513	Membrane-bound transcription factor site-2 protease

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.929	nucleic acid binding
GO:0003677	0.887	DNA binding
GO:0043565	0.514	sequence-specific DNA binding
GO:0140110	0.498	transcription regulator activity
GO:0003690	0.495	double-stranded DNA binding
GO:1990837	0.438	sequence-specific double-stranded DNA binding
GO:0003700	0.420	DNA-binding transcription factor activity
GO:0000976	0.371	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0010468	0.972	regulation of gene expression
GO:0009987	0.958	cellular process
GO:0032501	0.919	multicellular organismal process
GO:0048856	0.907	anatomical structure development
GO:0050794	0.863	regulation of cellular process
GO:0007275	0.846	multicellular organism development
GO:0080090	0.831	regulation of primary metabolic process
GO:0051171	0.831	regulation of nitrogen compound metabolic process
GO:0031323	0.829	regulation of cellular metabolic process
GO:0019219	0.775	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.736	regulation of RNA metabolic process
GO:0010556	0.670	regulation of macromolecule biosynthetic process
GO:0006355	0.655	regulation of DNA-templated transcription
GO:0044706	0.541	multi-multicellular organism process
GO:0044703	0.522	multi-organism reproductive process
GO:0007566	0.509	embryo implantation
GO:0048518	0.508	positive regulation of biological process
GO:0044238	0.495	primary metabolic process
GO:0071704	0.494	organic substance metabolic process
GO:0006807	0.436	nitrogen compound metabolic process
GO:0009893	0.424	positive regulation of metabolic process
GO:0010604	0.394	positive regulation of macromolecule metabolic process
GO:0043170	0.369	macromolecule metabolic process
GO:0040007	0.363	growth
GO:0031325	0.340	positive regulation of cellular metabolic process
GO:0051173	0.323	positive regulation of nitrogen compound metabolic process
GO:0044237	0.307	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.989	nuclear lumen
GO:0005654	0.971	nucleoplasm
GO:0005737	0.923	cytoplasm
GO:0043232	0.903	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]