StarFunc result for job id P0CB48

User Input

>input (400 residues)
MPAKDIKVALPRSQGHWSNADILRLLECMENNLPYDDNGTFSSTQSHMDWGKVAFKNFSG
EMCRLKWLEISCSLRKFSTLKKLVLEAKKCVKNTNKSQKGRNHPDFPKRLLTAYIRFFKE
NWPQYSQMYPGMRSQEVTKILSKKYKELPEQMKQKHIQDFRKEKQEFEEKLARFREEHPD
LDQKGKKSDICKRVQTKVQKKVQKNIEEVRSLPKTDQFFKKVKFHGEPQKPPMNGYQKFH
QDSWSSKELQHLSLRERMVEIGRRWQRIPQSQKDHYKSQAELLQKEYKVELDLWLKTLSP
EDYAAYKESTYAKGKNMAMMGGPAPSLKQTDPQSSSAKGLQEGFGEGQGLQAAGTEASQT
IWVNCQVSMEPEDNRKKDGEEEESSNSLDCSSGEDMEVDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CB47	0.308	0.313	8.436E-47	393	0.863	0.878	P0CB47.pdb.gz	UBFL1_HUMAN Upstream-binding factor 1-like protein 1 OS=Homo sapiens OX=9606 GN=UBTFL1 PE=1 SV=1
2	AFDB:Q3USZ2	0.407	0.413	1.496E-30	394	0.485	0.492	Q3USZ2.pdb.gz	UBFL1_MOUSE Upstream-binding factor 1-like protein 1 OS=Mus musculus OX=10090 GN=Ubtfl1 PE=1 SV=1
3	AFDB:E9PKP7	0.340	0.199	8.260E-24	745	0.362	0.195	E9PKP7.pdb.gz	E9PKP7_HUMAN Upstream binding transcription factor OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1
4	AFDB:P25976	0.364	0.205	8.929E-23	765	0.507	0.265	P25976.pdb.gz	UBF1_MOUSE Nucleolar transcription factor 1 OS=Mus musculus OX=10090 GN=Ubtf PE=1 SV=1
5	AFDB:Q24537	0.197	0.200	7.480E-4	393	0.117	0.120	Q24537.pdb.gz	HMG2_DROME High mobility group protein DSP1 OS=Drosophila melanogaster OX=7227 GN=Dsp1 PE=2 SV=1
6	AFDB:A0A024R1S7	0.196	0.191	9.688E-4	411	0.152	0.148	A0A024R1S7.pdb.gz
7	AFDB:Q9BIW6	0.198	0.109	2.217E-3	749	0.147	0.079	Q9BIW6.pdb.gz	Q9BIW6_DROME Brahma-associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=2 SV=1
8	AFDB:Q9USU7	0.169	0.212	7.290E-3	310	0.083	0.106	Q9USU7.pdb.gz	YHHB_SCHPO HMG box-containing protein C28F2.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC28F2.11 PE=1 SV=1
9	AFDB:Q08945	0.180	0.107	9.944E-3	709	0.100	0.056	Q08945.pdb.gz	SSRP1_HUMAN FACT complex subunit SSRP1 OS=Homo sapiens OX=9606 GN=SSRP1 PE=1 SV=1
10	AFDB:Q9MAT6	0.155	0.139	1.357E-2	448	0.095	0.085	Q9MAT6.pdb.gz	HMG15_ARATH High mobility group B protein 15 OS=Arabidopsis thaliana OX=3702 GN=HMGB15 PE=2 SV=1
11	PDB:1j5nA	0.164	0.618	9.218E-2	93	0.052	0.226	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7abgA4	0.107	0.106	5.939E-1	405	0.095	0.094	7abgA4.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
13	PDB:7r24A	0.123	0.250	6.254E-1	150	0.052	0.140	7r24A.pdb.gz
14	PDB:7ploI	0.116	0.103	1.672	451	0.037	0.033	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
15	PDB:6j6gc	0.070	0.065	2.529	436	0.117	0.108	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
16	PDB:5mp9M	0.087	0.090	2.954	381	0.025	0.026	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	PDB:2fbqA	0.096	0.162	3.826	213	0.048	0.089	2fbqA.pdb.gz
18	PDB:3bviF	0.075	0.153	4.469	173	0.060	0.139	3bviF.pdb.gz	Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
19	PDB:3euhB	0.082	0.096	4.469	321	0.048	0.059	3euhB.pdb.gz
20	PDB:5w7gA	0.073	0.183	4.469	131	0.037	0.115	5w7gA.pdb.gz	Model for a novel membrane envelope in a filamentous hyperthermophilic virus.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CB47	0.0	699	393	0.863	0.878	UBFL1_HUMAN Upstream-binding factor 1-like protein 1 OS=Homo sapiens OX=9606 GN=UBTFL1 PE=1 SV=1
2	Q3USZ2	2.99e-119	353	394	0.465	0.472	UBFL1_MOUSE Upstream-binding factor 1-like protein 1 OS=Mus musculus OX=10090 GN=Ubtfl1 PE=1 SV=1
3	E9PKP7	2.85e-82	268	745	0.365	0.196	E9PKP7_HUMAN Upstream binding transcription factor OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1
4	P17480	8.69e-72	241	764	0.282	0.148	UBF1_HUMAN Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1
5	P25976	8.92e-72	241	765	0.282	0.148	UBF1_MOUSE Nucleolar transcription factor 1 OS=Mus musculus OX=10090 GN=Ubtf PE=1 SV=1
6	P25977	9.15e-72	241	764	0.282	0.148	UBF1_RAT Nucleolar transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Ubtf PE=1 SV=1
7	E5KSU5	3.08e-06	50.4	246	0.105	0.171	E5KSU5_HUMAN Mitochondrial transcription factor A OS=Homo sapiens OX=9606 GN=TFAM PE=4 SV=1
8	Q00059	3.08e-06	50.4	246	0.105	0.171	TFAM_HUMAN Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1
9	H7BYN3	8.51e-06	48.9	219	0.052	0.096	H7BYN3_HUMAN Transcription factor A, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1
10	Q91ZW1	9.91e-06	48.9	244	0.100	0.164	TFAM_RAT Transcription factor A, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tfam PE=2 SV=1
11	P40630	2.50e-05	47.8	243	0.048	0.078	TFAM_MOUSE Transcription factor A, mitochondrial OS=Mus musculus OX=10090 GN=Tfam PE=1 SV=2
12	Q9VDL2	4.34e-05	47.0	257	0.107	0.167	Q9VDL2_DROME LD40493p OS=Drosophila melanogaster OX=7227 GN=TFAM PE=1 SV=1
13	Q86BR8	4.76e-05	47.0	284	0.107	0.151	Q86BR8_DROME Mitochondrial transcription factor A, isoform B OS=Drosophila melanogaster OX=7227 GN=TFAM PE=1 SV=1
14	C9JQA7	4.55e-04	42.4	142	0.052	0.148	C9JQA7_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
15	Q9Z104	5.14e-04	43.9	317	0.055	0.069	HM20B_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Mus musculus OX=10090 GN=Hmg20b PE=1 SV=1
16	C9J8X5	5.65e-04	43.1	215	0.052	0.098	C9J8X5_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
17	Q9P0W2	9.00e-04	43.1	317	0.052	0.066	HM20B_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
18	Q02486	0.002	41.6	183	0.058	0.126	ABF2_YEAST ARS-binding factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ABF2 PE=1 SV=1
19	Q9UVL1	0.006	38.1	92	0.058	0.250	NHP6_CANAL Non-histone chromosomal protein 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NHP6 PE=3 SV=1
20	Q9DC33	0.010	40.0	346	0.048	0.055	HM20A_MOUSE High mobility group protein 20A OS=Mus musculus OX=10090 GN=Hmg20a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06244 Ccdc124	10	17.8	Coiled-coil domain-containing protein 124 /Oxs1
2	PF09626 DHC	6.5e+02	12.8	Dihaem cytochrome c
3	PF14747 DUF4473	45	16.0	Domain of unknown function (DUF4473)
4	PF00505 HMG_box	4.9e-13	60.6	HMG (high mobility group) box
5	PF09011 HMG_box_2	3.2e-07	42.2	HMG-box domain
6	PF05478 Prominin	2.5e+02	11.1	Prominin
7	PF01765 RRF	9.6e+02	11.1	Ribosome recycling factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000015858

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000003605	0.721	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
2	9593.ENSGGOP00000002214	0.576	SPT16 homolog, facilitates chromatin remodeling subunit
3	9593.ENSGGOP00000000512	0.572	B double prime 1, subunit of RNA polymerase III transcription initiation factor IIIB
4	9593.ENSGGOP00000017061	0.571	Polymerase (RNA) I polypeptide E, 53kDa
5	9593.ENSGGOP00000005183	0.526	Zinc finger and SCAN domain containing 4
6	9593.ENSGGOP00000000508	0.523	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
7	9593.ENSGGOP00000009668	0.523	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
8	9593.ENSGGOP00000012068	0.515	FACT complex subunit SSRP1
9	9593.ENSGGOP00000028653	0.509	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.897	nucleic acid binding
GO:0003677	0.888	DNA binding
GO:0043565	0.496	sequence-specific DNA binding
GO:1990837	0.461	sequence-specific double-stranded DNA binding
GO:0000976	0.427	transcription cis-regulatory region binding
GO:0140110	0.372	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.992	regulation of gene expression
GO:0009987	0.950	cellular process
GO:0032501	0.925	multicellular organismal process
GO:0032502	0.885	developmental process
GO:0048856	0.867	anatomical structure development
GO:0050794	0.822	regulation of cellular process
GO:0007275	0.779	multicellular organism development
GO:0031323	0.720	regulation of cellular metabolic process
GO:0080090	0.717	regulation of primary metabolic process
GO:0051171	0.715	regulation of nitrogen compound metabolic process
GO:0051252	0.659	regulation of RNA metabolic process
GO:0009889	0.589	regulation of biosynthetic process
GO:0010556	0.584	regulation of macromolecule biosynthetic process
GO:0006355	0.568	regulation of DNA-templated transcription
GO:0044706	0.538	multi-multicellular organism process
GO:0022414	0.537	reproductive process
GO:0071704	0.492	organic substance metabolic process
GO:0006807	0.452	nitrogen compound metabolic process
GO:0043170	0.452	macromolecule metabolic process
GO:0044238	0.438	primary metabolic process
GO:0048518	0.434	positive regulation of biological process
GO:0044703	0.432	multi-organism reproductive process
GO:0009893	0.360	positive regulation of metabolic process
GO:0010604	0.339	positive regulation of macromolecule metabolic process
GO:0044237	0.334	cellular metabolic process
GO:0048522	0.301	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.993	nuclear lumen
GO:0005654	0.957	nucleoplasm
GO:0005737	0.952	cytoplasm
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0005730	0.477	nucleolus
GO:0032991	0.405	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]