StarFunc result for job id P0CF97

User Input

>input (657 residues)
MDHFFIKRKRNSEVKYTEACSSSSVESGIVNSDNIEKNTDSNLQTSTSFEPHFKKKKVSA
RRYNEDYLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAELIDKPLE
YFQRKKKDIKLSTQFLSCSTAVSEKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVR
TIFDDKSADKLKTIPNDNTVSLRICTIAEHLETMLITRLQSGIDFAIQLDESTDIGSCTT
LLVYVRYAWQDDFLEDFLCFLNLTSHLSGLDIFTELERRIVGQYKLNWKNCKGITSDGTA
TMTGKHSRVIKKLLEVTNNGAVWNHCFIHREGLASREIPQNLMEVLKNAVKVVNFIKGSS
LNSRLLETFCSEIGTNHTHLLYHTKIRWLSQGKILSRVYELRNEIHFFLIEKKSHLASIF
EDDTWVTKLAYLTDIFSILNELSLKLQGKNSDVFQHVERIQGFRKTLLLWQVRLKSNRPS
YYMFPRFLQHIEENIINENILKEIKLEILLHLTSLSQTFNHFFPEEKFETLRENSWVKDP
FAFRHPESIIELNLVPEEENELLQLSSSYTLKNDYETLSLSAFWMKVKEDFPLLSRKSVL
LLLPFTTTSLCELGFSILTQLKTKERNGLNCAAVMRVALSSCVPDWNELMNRQAHPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8TCP9	0.771	0.882	8.667E-62	573	0.653	0.749	Q8TCP9.pdb.gz	F200A_HUMAN Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1
2	AFDB:O95789	0.739	0.373	1.826E-44	1325	0.346	0.171	O95789.pdb.gz	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
3	AFDB:Q6R2W3	0.737	0.371	5.126E-43	1325	0.370	0.183	Q6R2W3.pdb.gz	SCND3_HUMAN SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCAND3 PE=1 SV=1
4	AFDB:B2RPU8	0.717	0.627	1.979E-42	756	0.332	0.288	B2RPU8.pdb.gz	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
5	AFDB:Q8IZ13	0.710	0.782	1.553E-37	594	0.291	0.322	Q8IZ13.pdb.gz	F200C_HUMAN Protein FAM200C OS=Homo sapiens OX=9606 GN=FAM200C PE=1 SV=1
6	AFDB:A0A494C1N8	0.573	0.346	6.483E-24	1116	0.212	0.125	A0A494C1N8.pdb.gz	A0A494C1N8_HUMAN GTF2I repeat domain containing 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
7	AFDB:Q8VEH5	0.606	0.651	1.329E-23	606	0.199	0.216	Q8VEH5.pdb.gz	EPMIP_MOUSE EPM2A-interacting protein 1 OS=Mus musculus OX=10090 GN=Epm2aip1 PE=1 SV=1
8	AFDB:Q7L775	0.613	0.657	2.963E-23	607	0.190	0.206	Q7L775.pdb.gz	EPMIP_HUMAN EPM2A-interacting protein 1 OS=Homo sapiens OX=9606 GN=EPM2AIP1 PE=1 SV=1
9	AFDB:Q99NI3	0.531	0.382	4.397E-20	936	0.198	0.139	Q99NI3.pdb.gz	GT2D2_MOUSE General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1
10	AFDB:Q9HCI6	0.498	0.422	4.101E-17	787	0.155	0.130	Q9HCI6.pdb.gz	K1586_HUMAN E3 SUMO-protein ligase KIAA1586 OS=Homo sapiens OX=9606 GN=KIAA1586 PE=1 SV=2
11	PDB:2ivnA	0.133	0.220	3.195E-1	325	0.059	0.120	2ivnA.pdb.gz	An Archaeal Orthologue of the Universal Protein Kae1 is an Iron Metalloprotein which Exhibits Atypical DNA-Binding Properties and Apurinic-Endonuclease Activity in Vitro.
12	PDB:6m5uA	0.128	0.141	4.671E-1	585	0.029	0.032	6m5uA.pdb.gz	Architecture of the herpesvirus genome-packaging complex and implications for DNA translocation.
13	PDB:3idhA	0.082	0.113	5.302E-1	453	0.011	0.015	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
14	PDB:5weaA	0.089	0.078	6.830E-1	764	0.021	0.018	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
15	PDB:4oo8D	0.098	0.066	7.432E-1	1163	0.085	0.048	4oo8D.pdb.gz	Crystal structure of Cas9 in complex with guide RNA and target DNA
16	PDB:5guhA	0.085	0.075	7.432E-1	759	0.032	0.028	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
17	PDB:4yduC	0.103	0.234	8.435E-1	230	0.018	0.052	4yduC.pdb.gz	The ATP-mediated formation of the YgjD-YeaZ-YjeE complex is required for the biosynthesis of tRNA t6A in Escherichia coli.
18	PDB:1m4mA	0.081	0.329	9.574E-1	112	0.024	0.143	1m4mA.pdb.gz	CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN
19	PDB:7qp9A	0.102	0.171	9.574E-1	327	0.059	0.119	7qp9A.pdb.gz	Structures and mechanism of the plant PIN-FORMED auxin transporter.
20	PDB:3w3uA	0.093	0.075	9.986E-1	1030	0.122	0.078	3w3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8TCP9	0.0	865	573	0.653	0.749	F200A_HUMAN Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1
2	Q6R2W3	1.19e-127	410	1325	0.359	0.178	SCND3_HUMAN SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCAND3 PE=1 SV=1
3	O95789	1.40e-126	407	1325	0.346	0.171	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
4	B2RPU8	1.46e-116	367	756	0.329	0.286	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
5	Q8IZ13	5.86e-101	322	594	0.297	0.328	F200C_HUMAN Protein FAM200C OS=Homo sapiens OX=9606 GN=FAM200C PE=1 SV=1
6	Q8CEW7	1.35e-87	286	583	0.242	0.273	Q8CEW7_MOUSE DUF4371 domain-containing protein OS=Mus musculus OX=10090 GN=Zbed5 PE=2 SV=1
7	A0A494C1N8	9.95e-33	137	1116	0.210	0.124	A0A494C1N8_HUMAN GTF2I repeat domain containing 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
8	Q6EKJ0	1.05e-32	137	949	0.209	0.144	GTD2B_HUMAN General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1
9	A0A494C0I1	3.87e-32	135	1111	0.212	0.125	A0A494C0I1_HUMAN GTF2I repeat domain containing 2 OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=1
10	Q86UP8	3.89e-32	135	949	0.212	0.146	GTD2A_HUMAN General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3
11	Q99NI3	1.03e-30	131	936	0.210	0.147	GT2D2_MOUSE General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1
12	Q8VEH5	2.26e-23	107	606	0.196	0.213	EPMIP_MOUSE EPM2A-interacting protein 1 OS=Mus musculus OX=10090 GN=Epm2aip1 PE=1 SV=1
13	Q7L775	4.49e-23	106	607	0.199	0.216	EPMIP_HUMAN EPM2A-interacting protein 1 OS=Homo sapiens OX=9606 GN=EPM2AIP1 PE=1 SV=1
14	D3Z5B1	3.45e-04	44.3	183	0.030	0.109	D3Z5B1_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like (Fragment) OS=Mus musculus OX=10090 GN=Zbed5 PE=4 SV=8
15	Q9HCI6	0.11	38.1	787	0.088	0.074	K1586_HUMAN E3 SUMO-protein ligase KIAA1586 OS=Homo sapiens OX=9606 GN=KIAA1586 PE=1 SV=2
16	F4IE28	0.22	37.4	769	0.040	0.034	F4IE28_ARATH TTF-type zinc finger protein with HAT dimerization domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=LOH3 PE=4 SV=1
17	P39077	2.9	33.5	534	0.033	0.041	TCPG_YEAST T-complex protein 1 subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CCT3 PE=1 SV=2
18	Q5GQ97	2.9	33.5	1046	0.058	0.036	Q5GQ97_CHICK Toll-like receptor 7 (Fragment) OS=Gallus gallus OX=9031 GN=TLR7 PE=3 SV=1
19	Q5ZJD0	3.6	33.5	1059	0.058	0.036	Q5ZJD0_CHICK Toll-like receptor 7-long OS=Gallus gallus OX=9031 GN=RCJMB04_19d10 PE=2 SV=1
20	Q9FZG4	4.0	33.1	493	0.021	0.028	HXKL1_ARATH Hexokinase-like 1 protein OS=Arabidopsis thaliana OX=3702 GN=At1g47840 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00653 BIR	8.9	18.3	Inhibitor of Apoptosis domain
2	PF05699 Dimer_Tnp_hAT	1.9e+02	13.2	hAT family C-terminal dimerisation region
3	PF14291 DUF4371	0.024	25.8	Domain of unknown function (DUF4371)
4	PF13741 MRP-S25	8.2e+02	10.9	Mitochondrial ribosomal protein S25
5	PF02892 zf-BED	15	17.0	BED zinc finger
6	PF18658 zf-C2H2_12	5.3	18.1	Spin-doc zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483930

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000467843	0.556	Biorientation of chromosomes in cell division protein 1-like 2
2	9606.ENSP00000326869	0.524	ORM1-like protein 1
3	9606.ENSP00000398617	0.518	Protein FAM71E2
4	9606.ENSP00000322242	0.501	RING finger protein 10
5	9606.ENSP00000430918	0.501	Type III endosome membrane protein TEMP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.986	biological regulation
GO:0050789	0.974	regulation of biological process
GO:0009987	0.937	cellular process
GO:0071704	0.911	organic substance metabolic process
GO:0044238	0.900	primary metabolic process
GO:0006807	0.818	nitrogen compound metabolic process
GO:0043170	0.759	macromolecule metabolic process
GO:0050794	0.643	regulation of cellular process
GO:0019222	0.463	regulation of metabolic process
GO:0050896	0.447	response to stimulus
GO:1901564	0.416	organonitrogen compound metabolic process
GO:0060255	0.411	regulation of macromolecule metabolic process
GO:0019538	0.362	protein metabolic process
GO:0070647	0.353	protein modification by small protein conjugation or removal
GO:0031323	0.343	regulation of cellular metabolic process
GO:0080090	0.336	regulation of primary metabolic process
GO:0032446	0.312	protein modification by small protein conjugation
GO:0044237	0.305	cellular metabolic process
GO:0051171	0.301	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.984	nucleus
GO:0016020	0.907	membrane
GO:0005737	0.811	cytoplasm
GO:0031981	0.776	nuclear lumen
GO:0005654	0.698	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]