StarFunc result for job id P0CG00

User Input

>input (497 residues)
MGQCRNWKWGLESFDFSINRRSSAPGQLESASQMRESWRHKAGRRMFSCPEESDPIQALR
KLTELCHLWLRPDLHTKEQILDMLVMEQFMISMPQELQVLVKVNGVQSCKDLEDLLRNNR
RPKKWSVVNFLGKEYLMQESDVEMAEIPASVRDDPRGVSSQRASSVNEMRPGEGQASQEL
QTLPRVPALSRRQEEDFLLPETTVMKSAPKALRPKPTLEKDLNVDREENTGLTSPEPQLP
NGPSVVGAKEGKEPKKRASVENVDADTPSACVVEREASTHSGSRGDALNLRCPKRSKPDA
TSISQEGPQGGATPVGNSESPGKPEINSVYSPGPAGAVSHPNGQEAKELLPFACGVCNKR
FTCNSKLAIHMRSHTGERPFQCNFCERCFTQLSDLRVHQRIHTGEKPYTCDICHKRFNRM
FSLKCHKRSHTGEKPYKCKDCNQVFTYRKNLNEHKLIHSGEKPYKCPKCLRAFRRPETLK
YHQKTHQETTAPRECEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10073	0.278	0.282	3.673E-21	491	0.256	0.259	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
2	AFDB:A0A024R4T5	0.153	0.105	5.300E-21	734	0.288	0.195	A0A024R4T5.pdb.gz
3	AFDB:O43309	0.279	0.233	2.163E-20	604	0.268	0.220	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
4	AFDB:Q9NX65	0.280	0.202	5.090E-20	697	0.282	0.201	Q9NX65.pdb.gz	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
5	AFDB:A2A761	0.274	0.233	1.660E-18	587	0.205	0.174	A2A761.pdb.gz	ZFP69_MOUSE Zinc finger protein 69 OS=Mus musculus OX=10090 GN=Zfp69 PE=3 SV=1
6	AFDB:Q15937	0.284	0.284	8.649E-18	498	0.207	0.207	Q15937.pdb.gz	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
7	AFDB:A2A9J5	0.274	0.214	1.410E-17	645	0.223	0.172	A2A9J5.pdb.gz	A2A9J5_MOUSE Zinc finger protein 980 OS=Mus musculus OX=10090 GN=Zfp980 PE=4 SV=1
8	AFDB:P52742	0.275	0.211	1.499E-17	658	0.171	0.129	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
9	AFDB:Q923B3	0.283	0.173	1.594E-17	828	0.294	0.176	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
10	AFDB:Q8TF47	0.279	0.220	1.694E-17	636	0.207	0.162	Q8TF47.pdb.gz	ZFP90_HUMAN Zinc finger protein 90 homolog OS=Homo sapiens OX=9606 GN=ZFP90 PE=1 SV=2
11	PDB:4hm9A	0.091	0.089	2.583	511	0.044	0.043	4hm9A.pdb.gz
12	PDB:4r8pL	0.054	0.090	3.298	254	0.036	0.071	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
13	PDB:7ad8D	0.047	0.071	3.298	280	0.024	0.043	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
14	PDB:6htsR	0.048	0.287	3.962	72	0.020	0.139	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
15	PDB:7kpxC	0.073	0.032	4.212	1352	0.032	0.012	7kpxC.pdb.gz
16	PDB:5gm6a	0.040	0.130	4.477	123	0.036	0.146	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:7zsb4	0.036	0.053	4.477	306	0.026	0.042	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
18	PDB:7kpvC	0.073	0.073	4.760	487	0.032	0.033	7kpvC.pdb.gz
19	PDB:7oniR	0.048	0.156	5.060	86	0.028	0.163	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
20	PDB:7uhyA	0.053	0.038	5.060	771	0.040	0.026	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NJL1	0.0	689	495	0.688	0.691	ZSA5B_HUMAN Zinc finger and SCAN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=ZSCAN5B PE=1 SV=1
2	Q9BUG6	0.0	701	496	0.690	0.692	ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ZSCAN5A PE=1 SV=1
3	P17022	1.79e-52	188	549	0.308	0.279	ZNF18_HUMAN Zinc finger protein 18 OS=Homo sapiens OX=9606 GN=ZNF18 PE=1 SV=2
4	O14978	4.65e-51	186	683	0.326	0.237	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
5	Q6NSZ9	1.01e-49	180	544	0.320	0.292	ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZSCAN25 PE=1 SV=3
6	Q07231	1.50e-47	174	555	0.280	0.250	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
7	Q8NF99	2.97e-47	173	534	0.284	0.264	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
8	Q9Y5A6	1.58e-46	170	473	0.268	0.281	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
9	Q53GI3	2.51e-45	169	561	0.284	0.251	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
10	Q6P9G9	5.69e-45	167	518	0.276	0.264	ZN449_HUMAN Zinc finger protein 449 OS=Homo sapiens OX=9606 GN=ZNF449 PE=1 SV=3
11	Q15697	1.05e-42	158	407	0.254	0.310	ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens OX=9606 GN=ZNF174 PE=1 SV=1
12	Q8CB76	1.95e-41	157	518	0.272	0.261	Q8CB76_MOUSE Zinc finger protein 449 OS=Mus musculus OX=10090 GN=Zfp449 PE=1 SV=1
13	Q6AYY1	7.06e-41	157	589	0.149	0.126	Q6AYY1_RAT Zinc finger protein 386 (Kruppel-like) OS=Rattus norvegicus OX=10116 GN=Zfp386 PE=2 SV=1
14	A0A0G2JYM8	8.42e-41	156	560	0.149	0.132	A0A0G2JYM8_RAT Zinc finger protein 386 (Kruppel-like) OS=Rattus norvegicus OX=10116 GN=Zfp386 PE=4 SV=1
15	Q3TN43	9.89e-41	156	591	0.147	0.124	Q3TN43_MOUSE Zinc finger protein 386 (Kruppel-like) OS=Mus musculus OX=10090 GN=Zfp386 PE=2 SV=1
16	Q99KB9	1.44e-40	156	626	0.147	0.117	Q99KB9_MOUSE Zinc finger protein 386 (Kruppel-like) OS=Mus musculus OX=10090 GN=Zfp386 PE=2 SV=1
17	Q1WWJ5	1.54e-40	156	626	0.147	0.117	Q1WWJ5_MOUSE Zinc finger protein 386 (Kruppel-like) OS=Mus musculus OX=10090 GN=Zfp386 PE=4 SV=1
18	Q5DTH6	2.13e-40	156	653	0.147	0.112	Q5DTH6_MOUSE MKIAA4205 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp386 PE=2 SV=1
19	Q9NQZ8	7.29e-40	152	489	0.149	0.151	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
20	O60304	1.90e-39	151	480	0.131	0.135	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02114 Phosducin	5.3e+02	10.9	Phosducin
2	PF02023 SCAN	7.9e-21	85.0	SCAN domain
3	PF00096 zf-C2H2	2.5e-15	67.1	Zinc finger, C2H2 type
4	PF13894 zf-C2H2_4	9e-11	52.7	C2H2-type zinc finger
5	PF13912 zf-C2H2_6	5.9	18.3	C2H2-type zinc finger
6	PF13465 zf-H2C2_2	1.1e-26	103.2	Zinc-finger double domain
7	PF12874 zf-met	0.51	22.0	Zinc-finger of C2H2 type
8	PF09723 Zn-ribbon_8	6.3	18.3	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000470691

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265965	0.569	Secretion-regulating guanine nucleotide exchange factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.830	nucleic acid binding
GO:0003690	0.762	double-stranded DNA binding
GO:1990837	0.750	sequence-specific double-stranded DNA binding
GO:0140110	0.348	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0010468	0.983	regulation of gene expression
GO:0031323	0.974	regulation of cellular metabolic process
GO:0051171	0.970	regulation of nitrogen compound metabolic process
GO:0019219	0.962	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.961	regulation of macromolecule biosynthetic process
GO:0031326	0.960	regulation of cellular biosynthetic process
GO:2001141	0.951	regulation of RNA biosynthetic process
GO:0048519	0.900	negative regulation of biological process
GO:0006355	0.883	regulation of DNA-templated transcription
GO:0048523	0.852	negative regulation of cellular process
GO:0009892	0.743	negative regulation of metabolic process
GO:0009890	0.693	negative regulation of biosynthetic process
GO:0045892	0.555	negative regulation of DNA-templated transcription
GO:0000122	0.526	negative regulation of transcription by RNA polymerase II
GO:0009987	0.524	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.987	nucleoplasm
GO:0005737	0.793	cytoplasm
GO:0005829	0.354	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]