StarFunc result for job id P0CG12

User Input

>input (524 residues)
MKEPRIFPRERPTPWTRAPLPPRGRLDGSLGPQGGPVLNTGHPLGVNSDPFLMAAGSLGG
NLTPFPRNPSPFPASSGSLASNPAPFPAGARDPSMASFPRGMNPTGTGAVSFPRPGGLLG
PGPGPGPTLNPRTGALPGPGPLSNPRLGGLPGPGPMSNPRAGGLLGAGPDPRGGGPMGPG
SGPNLRAGVLLTSGNGPPNPRPVGLGPGPNPNLRSGFLGTNPAPRSGVFPGPGLGPNPRP
SGLGPGPNLDARAGGLLGTGSGLNLRMAGPQGLDLAPILRAAGLLGANSASFSQASGNMG
TSPSSMARVPGPMGPNSGPSSRGIGLPGPNPSPMSRAPGPIGPNSAHFSRPVGPMGVNAN
PFPRGAGSSAFSQSSGTLASNPATFQRSAGLQGSNPTIFPRASGPLGPNPANFPRATGLQ
GPSPTTFPRSTGPLGPGQVTFPRPAAGHLGPSPAGPVGINPAPFTRPTGTLGLNPASFPR
MNGPAGKSFVPFPRVGSLPGTNPAAFPRPGGPMAAMYPNGMLPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:L0R4W3	0.083	0.083	5.131E-71	524	1.000	1.000	L0R4W3.pdb.gz	L0R4W3_HUMAN Alternative protein CHTF8 OS=Homo sapiens OX=9606 GN=CHTF8 PE=4 SV=1
2	AFDB:F4HXP0	0.059	0.051	1.439	651	0.153	0.123	F4HXP0.pdb.gz	F4HXP0_ARATH ARF GAP-like zinc finger-containing protein ZIGA4 OS=Arabidopsis thaliana OX=3702 GN=ZIGA4 PE=1 SV=1
3	AFDB:P08678	0.057	0.023	1.851	2026	0.179	0.046	P08678.pdb.gz	CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYR1 PE=1 SV=2
4	AFDB:P48479	0.061	0.044	2.190	858	0.204	0.125	P48479.pdb.gz	NIM1_NEUCR G2-specific protein kinase nim-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=nim-1 PE=2 SV=2
5	AFDB:P20357	0.042	0.017	2.590	1828	0.164	0.047	P20357.pdb.gz	MTAP2_MOUSE Microtubule-associated protein 2 OS=Mus musculus OX=10090 GN=Map2 PE=1 SV=2
6	AFDB:A2ABF9	0.067	0.031	3.332	1267	0.179	0.074	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
7	AFDB:O14594	0.061	0.031	3.623	1321	0.219	0.087	O14594.pdb.gz	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
8	AFDB:G1K325	0.064	0.043	4.661	942	0.198	0.110	G1K325.pdb.gz
9	AFDB:Q9ZQF9	0.055	0.044	5.997	704	0.187	0.139	Q9ZQF9.pdb.gz	MBR1_ARATH E3 ubiquitin-protein ligase MBR1 OS=Arabidopsis thaliana OX=3702 GN=MBR1 PE=1 SV=1
10	AFDB:O00268	0.069	0.038	6.522	1085	0.229	0.111	O00268.pdb.gz	TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens OX=9606 GN=TAF4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	L0R4W3	0.0	926	524	1.000	1.000	L0R4W3_HUMAN Alternative protein CHTF8 OS=Homo sapiens OX=9606 GN=CHTF8 PE=4 SV=1
2	P0CG12	0.0	926	524	1.000	1.000	DERPC_HUMAN Decreased expression in renal and prostate cancer protein OS=Homo sapiens OX=9606 GN=DERPC PE=1 SV=1
3	P51531	0.79	35.0	1590	0.059	0.019	SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2 PE=1 SV=2
4	Q9Y6V0	1.8	33.9	5142	0.105	0.011	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
5	Q6DIC0	4.6	32.7	1577	0.057	0.019	SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1
6	A6NGQ3	9.0	31.6	8923	0.088	0.005	A6NGQ3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=OBSCN PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008965506.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008959184.1	0.551	Chromosome transmission fidelity protein 18 homolog isoform X1
2	9597.XP_003822646.1	0.541	Sister chromatid cohesion protein DCC1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.420	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0016043	0.950	cellular component organization
GO:0048523	0.878	negative regulation of cellular process
GO:0032501	0.632	multicellular organismal process
GO:0019222	0.447	regulation of metabolic process
GO:0051171	0.424	regulation of nitrogen compound metabolic process
GO:0080090	0.418	regulation of primary metabolic process
GO:0060255	0.418	regulation of macromolecule metabolic process
GO:0019219	0.409	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.396	regulation of macromolecule biosynthetic process
GO:0051252	0.392	regulation of RNA metabolic process
GO:0010468	0.388	regulation of gene expression
GO:0032502	0.351	developmental process
GO:0048856	0.343	anatomical structure development
GO:0008152	0.338	metabolic process
GO:0031326	0.328	regulation of cellular biosynthetic process
GO:2001141	0.303	regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.506	cytoplasm
GO:0005576	0.338	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]